(data stored in ACNUC10821 zone)

EMBL: AE017262.PE551

AE017262.PE551       Location/Qualifiers
FT   CDS_pept        573617..575668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0559"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0530"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03341"
FT                   /protein_id="AAT03341.1"
FT                   /translation="MKKLTVIGLLMFAVLFLYRPDVLAADKNYQTVFGTDKTAQGKFTT
FT                   TKQNFTVENYWDVSNANVKLVYTITQLSEKEVSTMTLKINDVAFYSFKPDKADKGTKQI
FT                   EIEIPKDKLKKGVNVLSIESFVYTDLPDGRCTIDDTPANWLQFDKTSAVNVSYSDKAFQ
FT                   KTIAEFGERFTGIDTVKSEQGAVAVSNKAGDAELGAALEGLSGFSAVNTLEDKNIAFGQ
FT                   YEEAKTRDGKNYLVLFSSYDNLPNDLKSQIKDDNKLEKQALFQVVTVGNTNTLVVTSKS
FT                   NDALKKAGKLIANQNYLSQLGTNTKWLTTDEKIDTPATNVDKNTKLTTTGDKLKGIGHI
FT                   TQDYFISMPANRSASTGTEVSLDFRYAQNLDFEHSLVTILVNGKPIGSQKLTAKKANGD
FT                   KLTFQIPSDLNVKGDFSVTVAFDLVLTNNYCGFIADSEIPWAYITPESKINLNTSEETD
FT                   LLFEQYPYPFIANGDFNNAVVVVPDKLTTEDTDSLANIFNLLGRFHDGNRGDLTAVHAA
FT                   NWKKPKEGSNIIAVGTMNNNPVIKNANDDLYFQYNKTGDYFLSNEKISIEKNYGKQLGS
FT                   VQLITSDGVPILAVTGPGAKQTELGSDLIATKANLAKIYGDGAIVDTDNTIHSYRFKKA
FT                   ADTQEESFGSKISNNKEVTVFGAFALLTVVILVVAVLLILRKYRRSRK"
     atgaaaaaat taactgtaat cgggctgctt atgttcgccg tactatttct gtataggcca        60
     gacgttctcg cagcagataa aaactatcaa acggtttttg gaacagataa aaccgcccaa       120
     ggaaaattca caaccaccaa acaaaacttc acggtggaaa actactggga tgtatcaaac       180
     gctaacgtaa agcttgtgta tacaattacc caactgagcg aaaaagaagt ttccacgatg       240
     acactgaaaa taaacgatgt tgcgttctac tcttttaaac cagataaagc ggacaaagga       300
     acaaaacaga ttgaaatcga aattccgaaa gataagttaa aaaaaggagt caatgttcta       360
     tccatcgaaa gctttgtcta cactgatttg cctgatggtc gttgtacgat tgacgataca       420
     cctgccaact ggctgcaatt cgataaaaca agcgcagtaa acgtatctta ttccgataag       480
     gctttccaaa aaacgattgc cgagtttggc gagcgcttca ctggaattga tactgtgaaa       540
     agtgaacaag gcgcagtagc tgtctcaaac aaagccggcg atgccgaact tggcgcagca       600
     cttgaagggc tttccggatt ttctgcggtg aatacgttag aagataaaaa tatcgctttt       660
     ggtcaatacg aggaagcaaa aacgcgtgac ggtaaaaact atctcgtact tttttcaagc       720
     tatgacaatt taccaaatga tcttaaatca caaataaaag acgataataa attagaaaaa       780
     caagcacttt tccaagtagt gacagtcgga aatacgaata cactcgtggt tacttctaaa       840
     tccaacgatg cactaaaaaa agctggcaaa ctaatcgcca accaaaatta cttaagtcag       900
     cttggaacaa atactaaatg gctaacaaca gacgaaaaaa tcgacacacc agcgactaat       960
     gttgacaaaa atacgaaact aacaacaact ggcgataaac taaaaggcat tggtcatatc      1020
     acacaagatt acttcatcag catgccagcc aaccgtagcg catcaacagg aacagaagta      1080
     tcacttgatt ttagatatgc gcaaaacttg gatttcgagc attcattagt aacgatttta      1140
     gtgaacggaa aaccaatcgg cagccaaaaa cttaccgcta aaaaagccaa tggcgacaaa      1200
     ttaacgttcc aaattccgag cgatttaaac gtaaaagggg atttttcagt taccgttgcc      1260
     tttgatttag ttttaacaaa taactattgt ggctttattg cagattctga aatcccgtgg      1320
     gcgtatatca ccccagaatc aaaaatcaat ttaaacacaa gcgaagaaac agacttactt      1380
     tttgaacaat atccgtaccc atttattgca aatggtgact ttaacaatgc agttgtcgtt      1440
     gttcctgata aattaacgac agaagataca gattcattag caaatatttt caatctgtta      1500
     ggccgcttcc atgatggaaa taggggagac ttgactgccg tacatgccgc caactggaaa      1560
     aaaccaaaag aaggatcgaa tattattgca gttggtacaa tgaataataa tccagtaatt      1620
     aaaaacgcca atgacgacct atatttccag tacaacaaaa caggcgatta cttcctttcc      1680
     aatgaaaaaa tctcgattga aaaaaattac ggcaaacaac ttggtagtgt gcagttaatt      1740
     acatcagatg gcgtcccaat tctggcagtt actggtccag gtgccaaaca aacagaactc      1800
     ggatcggatt taatcgcaac aaaagccaac ctagctaaaa tttacggaga tggcgccatt      1860
     gttgatactg ataacacgat acattcctac cgattcaaaa aagcagcaga cacacaggaa      1920
     gaaagctttg ggtcaaaaat cagtaataac aaagaagtca ctgtgttcgg agcattcgcg      1980
     cttctaaccg tcgttatctt agttgtcgct gtcctactaa tcttgcgtaa atatcgccgg      2040
     agccggaagt ga                                                          2052
//

If you have problems or comments...

PBIL Back to PBIL home page