(data stored in ACNUC10821 zone)

EMBL: AE017262.PE554

AE017262.PE554       Location/Qualifiers
FT   CDS_pept        577505..577774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0562"
FT                   /product="ACT domain protein"
FT                   /note="identified by match to protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03344"
FT                   /db_xref="GOA:Q723B7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723B7"
FT                   /protein_id="AAT03344.1"
FT                   /translation="MRAVLTVIGKDNVGIVAGVSNKLAELNINIVDVSQTIMDGYFTMM
FT                   MMCDISQITKEFDEVKAELAGKGEDLQVKIHIQREEIFNAMHKL"
     gtgagagctg tacttactgt aattggaaaa gataatgtgg gtattgtcgc aggtgttagt        60
     aataaattag ctgaactgaa tatcaatatt gtggatgtat cccaaacgat tatggatggt       120
     tattttacga tgatgatgat gtgcgatatt agccaaatca cgaaagaatt tgatgaagta       180
     aaggcagaat tagccggtaa aggcgaggac ctccaagtaa aaatacatat tcagcgggaa       240
     gaaattttca acgcaatgca caaactttag                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page