(data stored in ACNUC10821 zone)

EMBL: AE017262.PE555

AE017262.PE555       Location/Qualifiers
FT   CDS_pept        577793..579148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03345"
FT                   /db_xref="GOA:Q723B6"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723B6"
FT                   /protein_id="AAT03345.1"
FT                   /translation="METNQILETIRMIEEEKLDIRTITMGISLLDCMDGDGEVARKKIY
FT                   QKIVTKARNLVAVGEAIESEFGIPIINKRISVTPIAIIAGSSADTDYVEFAKTLDAAAK
FT                   EVGVNFIGGYSALVQKGYTKGDEILIRSIPQALAQTERVCSSVNVGSTRTGINMDAVRQ
FT                   MGEVIKETADLTADTQGLGCAKLVVFANAVEDNPFMAGAFHGVGEADCVINVGVSGPGV
FT                   VKRAIEKVKGEPFDIVAETVKQTAFKITRMGQLVGQVASEKLGVPFGIVDLSLAPTPAI
FT                   GDSVAHILEEMGLEMVGTHGTTAALALLNDAVKKGGVMACGHVGGLSGAFIPVSEDAGM
FT                   IEAVQQGALNLEKLEAMTAICSVGLDMIAVPGDTTAETLAAMIADEAAIGVINNKTTAV
FT                   RVIPASGTKVGDMVEFGGLLGTAPVMPVNGKSSVDFIARGGRIPAPIHSFKN"
     atggaaacaa atcaaatttt agaaacgata cgaatgattg aagaagaaaa attggacatc        60
     cggacgatta caatgggaat ttctttgcta gattgtatgg acggcgacgg cgaagtggct       120
     cgaaagaaaa tctatcaaaa aatcgttacc aaagcgcgta atttagttgc agttggtgaa       180
     gcgattgaat ctgagtttgg cattccaatt attaataaac gaatttctgt cactccgatt       240
     gcgattatcg ctggatcaag cgcagatact gactacgtag aatttgcgaa aacacttgat       300
     gctgctgcaa aagaggttgg cgtgaatttt attgggggct attccgcact cgttcaaaaa       360
     ggctacacga aaggtgacga aatcctgatt cgctcgattc cgcaagcact cgcacaaacg       420
     gaacgcgtat gctcatcggt caatgttggc tcgacgcgaa cgggaatcaa tatggatgct       480
     gtccgccaaa tgggcgaggt aatcaaagaa acggcagact taacagcaga tacgcaaggc       540
     ctaggttgcg cgaaactcgt tgtatttgcc aatgctgtcg aggataatcc ttttatggcc       600
     ggagcattcc atggtgttgg tgaagcggac tgcgttatca atgttggtgt cagcggccca       660
     ggtgtggtga aacgtgctat tgaaaaagta aaaggcgaac cgtttgatat cgttgctgaa       720
     acagtcaaac aaacagcgtt taaaatcact agaatgggtc aactcgttgg ccaagtcgct       780
     tccgaaaaac taggcgttcc ttttgggatt gtcgatttat cacttgcacc aactccagcg       840
     attggtgatt cggtcgcaca cattttggaa gagatgggac tagaaatggt tggaacacat       900
     ggcacgacag ccgcactcgc acttttaaat gacgcagtga aaaaaggcgg cgtaatggct       960
     tgtggacatg tcggtggttt atcaggcgca ttcattcctg tttctgagga tgcgggtatg      1020
     attgaagctg tgcagcaagg ggcgctcaac ctcgaaaaat tagaagcaat gacagcaatt      1080
     tgttcggttg gtctggatat gattgccgta ccaggtgaca caactgccga aacattagca      1140
     gcaatgattg cggatgaagc ggctattggc gtcattaaca ataaaacaac tgctgtccga      1200
     gtgattccag caagtggcac caaagttggc gacatggtcg aattcggcgg cttacttggc      1260
     acggcaccag taatgccagt aaacggaaaa tcgtctgtgg acttcattgc tcgcggcggt      1320
     cgaatcccag caccaattca ttcttttaaa aactaa                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page