(data stored in ACNUC10821 zone)

EMBL: AE017262.PE557

AE017262.PE557       Location/Qualifiers
FT   CDS_pept        580328..581650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0565"
FT                   /product="glycosyl hydrolase, family 4"
FT                   /note="identified by match to protein family HMM PF02056"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03347"
FT                   /protein_id="AAT03347.1"
FT                   /translation="MKKGVKIVTIGGGSSYTPELVEGFIKRYHELPIRELWLVDIEAGR
FT                   EKLEIVGNMAKRMVKAANIDCEVHLTLDRREALKDADFVTTQFRVGLLDARIKDERIPL
FT                   SHGIIGQETNGAGGMFKAFRTIPVILGIVEDMRELCPDAWLINFTNPAGMVTEAVLRYG
FT                   NWDKVIGLCNVPIGAVKSASDVLEKPEEDLFFKFAGINHLHWHRVFDKDGTELTEKVID
FT                   GLYAPDANPGKVVENIKNMRFLYEQVKHLKMLPCPYHRYYYMTDAMLEEELASFKNEGT
FT                   RGEVVKKLEDSLFELYKDPNLDYKPEELSKRGGAHYSDAACEIINSIYNNKGTVMVVST
FT                   RNNGAIDDVPYDSAVEITSVIRAHGAEPINFGKFPPAQRGLLQVMKSMEELTIEAAVTG
FT                   DYATALQAFTSNPLVPSGDLAKTILDEMLEAHKEFLPQFAK"
     atgaaaaaag gtgtaaaaat cgttacaatt ggtgggggtt ccagttacac accagaactt        60
     gttgaaggat ttattaaacg ctatcatgaa cttccaatca gagaactttg gctagtagat       120
     attgaagctg gtcgtgaaaa attagaaatc gttggtaata tggcaaaacg tatggtcaaa       180
     gcagcaaaca ttgactgcga agtacattta acacttgacc gtcgtgaagc tctaaaagat       240
     gcagattttg ttacaacaca atttcgtgtt ggtttattag acgctcgtat taaagatgaa       300
     agaattccac ttagccacgg catcatcggt caagaaacaa acggagcggg cggaatgttt       360
     aaagctttcc gtacgattcc tgtcattctt ggtatcgttg aagatatgcg cgaactttgc       420
     ccagatgctt ggttaatcaa cttcacaaac ccagcaggta tggtaacaga agccgttctt       480
     cgttacggca actgggataa agttatcggt ctttgtaacg tgccaatcgg agcagtgaaa       540
     agcgcatccg acgttttaga aaaaccagaa gaagacttat tcttcaaatt tgctggaatc       600
     aaccacttgc actggcaccg cgtattcgac aaagatggta ccgaattaac agaaaaagtt       660
     atcgacggcc tttatgcacc agatgctaac ccaggaaaag tcgttgaaaa cattaaaaac       720
     atgcgcttct tatatgagca agttaaacat ctaaaaatgc ttccttgtcc atatcaccgt       780
     tactactaca tgacggatgc aatgcttgaa gaagaactgg catctttcaa aaacgaaggt       840
     actcgcggag aagtcgtgaa aaaactagaa gacagcttat tcgaattata taaagaccca       900
     aatcttgatt acaaaccaga agaattatcc aaacgaggcg gcgcacatta cagtgatgca       960
     gcatgtgaaa tcatcaattc catttacaac aacaaaggta ccgtaatggt agtatctact      1020
     cgtaataacg gcgcaattga tgacgttcct tacgatagtg ctgtagaaat cacaagtgtt      1080
     atccgtgcgc atggcgcaga accaatcaac ttcggtaaat tcccaccagc acaacgcggc      1140
     ttactacaag taatgaaatc catggaagaa ttgactatcg aagcagcagt aacaggcgat      1200
     tacgcaactg cactacaagc attcacttct aacccactcg ttccaagcgg cgacttagca      1260
     aaaacaattc tagatgaaat gctagaagca cacaaagagt ttttaccaca attcgctaaa      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page