(data stored in ACNUC10821 zone)

EMBL: AE017262.PE558

AE017262.PE558       Location/Qualifiers
FT   CDS_pept        581754..583025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0566"
FT                   /product="putative N-carbamoyl-L-amino acid amidohydrolase"
FT                   /note="identified by similarity to SP:Q01264; match to
FT                   protein family HMM PF01546; match to protein family HMM
FT                   PF07687; match to protein family HMM TIGR01879"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03348"
FT                   /protein_id="AAT03348.1"
FT                   /translation="MQTNLERIKKHIEKLDTYTATPGQGTTRLTYSKEDLDARNYLKQE
FT                   MAKVGLAVSEDAIGNIYGRLEGENPNLPAVIVGSHFDSVPNGGAFDGPAGVITGLEVAT
FT                   VFYEQQIKPHFPLEIIAMVEEEGARFGAGLLASRTITGKVTKEMLHEMKDIDGITAAEA
FT                   MAKVGFDANQVVTAIRTKESVKAFIELHIEQGPVLENANEDVALVDTVVGLTEIKVTVK
FT                   GQAGHAGTTPMLDRKDALITAVEILGQLPELAIQEGGGTVLTVGKLNVYPNGANVIPDK
FT                   VVFTVDIRAKDEIHVQNTLAKTKEIIQSAEKNGITCEIEDMLYEPPTHLSKEIHQALTE
FT                   SADQLGLKYRTMVSGAGHDAMIFAGLTEVGLIFVPSHNGISHAPEEWTDYDKLQKGIEV
FT                   VLETVKKWTEESANESENKTSSFK"
     atgcaaacaa atcttgaaag aataaaaaaa cacatagaaa aattagatac ttatacagca        60
     actccgggtc agggaacaac tcggcttaca tatagcaaag aagacctcga cgcgcgcaac       120
     tatttaaaac aagaaatggc taaagtaggc cttgctgttt cagaagatgc gattggaaat       180
     atctacggac gactagaagg cgaaaatcca aatttaccag cagtaattgt cggctctcat       240
     tttgactctg taccaaatgg tggtgctttt gatggaccag ctggcgtcat taccggactt       300
     gaagtagcca ctgttttcta tgaacaacaa attaaaccac attttccgct tgaaattatt       360
     gcgatggtgg aagaagaagg cgctcgtttt ggcgctggcc tccttgcttc acgtacaatt       420
     actggcaaag ttaccaaaga aatgctccat gaaatgaaag atatagatgg aattacagcc       480
     gcagaagcca tggcaaaagt aggatttgat gcaaatcaag tagttacagc tatccgcacg       540
     aaagaatccg ttaaagcatt tatcgaacta cacattgagc aaggaccagt cctagaaaat       600
     gccaatgaag atgtggcgct agtagataca gtagtcggtt taacagaaat aaaagtaaca       660
     gtaaaaggac aagccggcca tgcaggcaca accccaatgc ttgaccgaaa agatgcgctg       720
     atcacagctg tcgaaatttt aggtcaacta ccagaactag ctatccaaga aggcggcgga       780
     actgtattaa cagtgggcaa actcaacgtc tatccaaatg gcgcaaacgt tattccagat       840
     aaagtcgttt ttaccgtaga tatccgagca aaagacgaaa ttcacgtcca aaatacatta       900
     gcaaaaacaa aagaaattat ccaatccgca gagaaaaacg gcatcacttg cgaaatagaa       960
     gatatgctat acgaaccgcc gacccattta tcaaaagaga ttcatcaagc attgactgaa      1020
     agtgccgacc aactcggctt aaaataccga acaatggtta gcggggccgg acacgatgca      1080
     atgatttttg caggtttaac cgaagtaggc ttgatttttg tccctagcca caatggtata      1140
     agccatgcgc ccgaagaatg gacggattac gacaaactcc aaaaaggaat cgaagtcgta      1200
     ctggaaacag taaaaaaatg gacggaggaa agcgcgaatg aatcagaaaa taaaacaagc      1260
     agttttaaat aa                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page