(data stored in ACNUC10821 zone)

EMBL: AE017262.PE559

AE017262.PE559       Location/Qualifiers
FT   CDS_pept        582991..584166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0567"
FT                   /product="putative carboxypeptidase"
FT                   /note="identified by similarity to SP:P80092; match to
FT                   protein family HMM PF01546; match to protein family HMM
FT                   PF07687; match to protein family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03349"
FT                   /protein_id="AAT03349.1"
FT                   /translation="MNQKIKQAVLNNEEAMIAFRRDLHMHPELQWQEFRTTDKVAKELD
FT                   KLGIPYRRTEPTGLIAELKGGKSGKTVALRADMDALPVQELNQDLPYKSTEDGKMHACG
FT                   HDAHTAMLITAAKALVEIKDELPGTVRFIFQPSEEIAEGAKAMIAQGAMEGVDHVFGIH
FT                   IWSQTPSGKISCVVGSTFASADIIQIDFKGQGGHGAMPHDTIDAAVIASSFVMNLQSIV
FT                   SRETDPLDPVVVTIGKMDVGTRYNVIAENARLEGTLRCFNNITRAKVAKSIEHYAKQTA
FT                   AIYGGKAEMIYKQGTQPVINDEKSALLVQETITESFGEEMLYFERPTTGGEDFSYFQDE
FT                   APGSFALVGCGNPEKDTEWAHHHGRFNIDESVMKNGAELYAQFAYNFLNQN"
     atgaatcaga aaataaaaca agcagtttta aataatgaag aagcaatgat tgccttccgc        60
     cgtgatttgc acatgcatcc cgaactccaa tggcaggaat ttagaactac cgacaaagtt       120
     gccaaagaat tggacaaact gggcattcct taccgccgca cggaaccaac cggattaatc       180
     gcggaactca aaggcgggaa atcagggaaa acagttgcct tgcgtgccga tatggacgca       240
     ctcccagtcc aagaactaaa ccaagacctc ccatataaat ccacagaaga cggcaaaatg       300
     catgcctgtg gtcatgatgc tcatacagcg atgctaataa ccgcggcaaa agcactcgta       360
     gaaataaaag acgaactacc cggaacagtg cgcttcattt ttcaaccttc agaagaaatt       420
     gcagagggtg cgaaagctat gatagcccaa ggagcgatgg aaggcgtgga ccacgtgttt       480
     gggattcata tctggtccca aactccaagt ggaaagatat cgtgcgtagt cggctccaca       540
     ttcgcctccg cagatattat ccaaatcgac ttcaaaggac aaggtggtca cggagcaatg       600
     ccgcatgaca caatcgacgc tgctgtaatt gcttcctcat tcgttatgaa cctccaatcc       660
     atcgtatcac gcgaaacaga tccacttgat ccagtcgtag taactatcgg caaaatggat       720
     gtcggcactc gctacaatgt tatcgcagag aatgcccgtt tggaaggaac gcttcgttgc       780
     ttcaacaaca taacacgcgc caaagtcgca aaatcaattg aacactacgc caaacaaacc       840
     gccgctatct acggtggcaa ggcagaaatg atatacaaac aaggcacaca accagtaatc       900
     aacgacgaaa aaagcgcact actcgtccaa gaaacaatca cagaatcatt cggcgaagag       960
     atgctttact ttgaacgtcc aaccacgggc ggcgaagact tcagctattt tcaagatgaa      1020
     gctcccggaa gtttcgcact cgttggctgc ggcaatccag aaaaagacac cgaatgggcg      1080
     catcaccatg gccgatttaa tattgacgaa agtgtcatga aaaatggcgc cgagctatat      1140
     gcccagtttg cgtataattt tttaaatcaa aattaa                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page