(data stored in ACNUC10821 zone)

EMBL: AE017262.PE562

AE017262.PE562       Location/Qualifiers
FT   CDS_pept        complement(586701..587621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0570"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03352"
FT                   /protein_id="AAT03352.1"
FT                   /translation="MYQKHKWAAILMTVLLAVVLTACGSSSDKDSSKEKESATKTVTDT
FT                   MDRKVEVPTTPKRIVALQNVSEMEILGVKPVGTTDYYITTYPEATKGTESVGNDKPSIE
FT                   KIANLKPDLIIISDYQKDLLENLEKVAPVYITHFGDTPDKQLSNIANLLNKKAEKEKWD
FT                   KDYAASSKEAKATLKDAGVANEKAAVIQFYGKEIYVHDAKVFDGLYSGAGFTPTDAAKA
FT                   NKETKAISSEAIPEYAAGADRLFILMPADGNTDSVDEMLKGVWKDIPAVKKNQVYKVDN
FT                   TKWSDYSASAQLYQMEDAVKQITGK"
     atgtaccaaa agcataaatg ggctgctatt ttgatgactg tgcttttagc agtagtatta        60
     accgcttgtg gcagttcttc ggataaagac tcaagcaaag aaaaggaatc cgcaacaaaa       120
     acggtcactg atacaatgga ccgtaaagta gaagttccaa caacaccgaa aagaattgtc       180
     gcacttcaaa atgtaagtga aatggaaatt cttggcgtta aacctgttgg tacaactgat       240
     tattacatca ctacataccc tgaggcaaca aaagggaccg aaagtgttgg taatgacaaa       300
     cctagtattg aaaaaatcgc taatttaaaa ccagacttaa ttattattag tgattaccaa       360
     aaggatcttt tagagaactt ggaaaaagtg gctcctgttt atatcacgca ttttggtgat       420
     actccggaca aacaactttc gaacattgcc aatctcttaa ataaaaaagc agaaaaagaa       480
     aaatgggaca aagattacgc ggcaagctct aaagaagcaa aagcaacact caaagatgct       540
     ggtgttgcga acgaaaaagc ggcagtaatt caattttatg gcaaagaaat ctatgtgcac       600
     gatgcaaaag tctttgacgg cttatactcc ggcgcaggtt tcacaccgac agatgctgct       660
     aaagcaaaca aagaaacaaa agctatttct agtgaagcaa ttcctgaata tgcagcagga       720
     gcagatcgtc tctttatctt aatgccagct gatggcaata ccgattctgt ggatgaaatg       780
     ctaaaaggtg tttggaaaga tattccagct gtgaagaaaa accaagtgta taaagtggat       840
     aatactaaat ggagtgacta cagtgcctct gctcaacttt atcaaatgga agatgctgta       900
     aaacaaatta ctggtaaata a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page