(data stored in ACNUC10821 zone)

EMBL: AE017262.PE566

AE017262.PE566       Location/Qualifiers
FT   CDS_pept        complement(589654..590034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0545"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03356"
FT                   /protein_id="AAT03356.1"
FT                   /translation="MNIVLIASLIFIAQTGLAFFQVRYYQHHMNKVADKYAEKTGYYLY
FT                   SEMERLKFRTSAVAILVVNENRVVHECQILTGKTVFAKFKTFTNYHHKDLSEILTDLSS
FT                   KNKNTIQEKAIIKTVNSCMKAL"
     atgaatattg tccttattgc ttccctcatt ttcatcgctc agacaggtct tgcttttttc        60
     caagtgaggt attatcagca tcatatgaac aaagttgcgg ataaatatgc tgagaaaact       120
     ggttattatc tttattccga aatggaacga ctcaaatttc gcacaagtgc tgtagccatt       180
     ctggtagtga atgaaaaccg agttgtacat gaatgccaaa ttttaaccgg aaagactgtt       240
     tttgcaaagt tcaagacttt caccaactat catcataaag atttatccga aatattgacg       300
     gatcttagta gtaaaaataa gaatacaatc caagaaaaag caattattaa aacagtcaac       360
     agttgcatga aagcgcttta a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page