(data stored in ACNUC10821 zone)

EMBL: AE017262.PE569

AE017262.PE569       Location/Qualifiers
FT   CDS_pept        592912..593577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412992"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03359"
FT                   /protein_id="AAT03359.1"
FT                   /translation="MEKLFTYKEFVDMMQKYGIRHTKRKLRRGENLMENASKFSNVVLL
FT                   IDGYISSYTYESPEKLLSIFEPGIFLRYSILEDQPEFVTNIALSDNCEVYEYKKEDIEY
FT                   ALTLFPENFGFQYFFLKRIGRHLYYRALLNGKEHKDKLYYAMKYLGELIGKTDENGNVS
FT                   LPPEVTLKVLIEYSTLSKAAFYRQRIHLLEQEILKPHENTFIVQKKVASHYEDQLTSI"
     gtggaaaagt tatttacata taaagagttt gttgacatga tgcaaaaata tgggattaga        60
     cacacgaaac gcaagctaag acgtggcgaa aatttaatgg agaacgcttc taaatttagt       120
     aatgttgttt tactaataga tggttatata agcagttata catatgaatc tccagaaaaa       180
     ctcttatcta tatttgaacc aggtattttt ctacgttatt ccattttaga agatcagcca       240
     gagtttgtga caaatattgc tctctcagat aactgtgaag tatacgaata taaaaaagaa       300
     gatattgaat atgcattaac attatttccc gaaaattttg gttttcagta tttctttcta       360
     aagagaatcg ggcggcattt atattatcga gcattactta acggcaaaga gcataaagat       420
     aaactatatt atgccatgaa atatttggga gaactcattg gtaaaacgga tgaaaacgga       480
     aatgtttcgt tgccaccaga agtgacattg aaagtcttaa ttgaatacag tactttatcc       540
     aaagcagctt tttatagaca acgaattcac ttattggagc aagaaatttt aaaaccgcat       600
     gaaaatactt ttattgttca aaaaaaagta gcaagtcatt atgaagacca gctaactagc       660
     atttaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page