(data stored in ACNUC10821 zone)

EMBL: AE017262.PE571

AE017262.PE571       Location/Qualifiers
FT   CDS_pept        595668..595964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03361"
FT                   /protein_id="AAT03361.1"
FT                   /translation="MKKMGFILICCLFVCASPFYVKANTDKATSKAGVIFTHDPRKPRT
FT                   GTDDRSGTFPTKVPPKRLPKTGDTTDFYLVLLGFGFILIAKKGYFKEVREEIR"
     ttgaaaaaaa tgggattcat tttaatctgt tgtttatttg tgtgcgcctc gccgttttat        60
     gtaaaagcga atacggataa ggcgacaagt aaagcgggag tgattttcac gcatgacccc       120
     cgaaaaccaa gaactggaac agatgacaga agcggcactt ttccgaccaa agttcctcca       180
     aaaagactgc cgaaaacagg agatacaact gatttttatc ttgttttact agggtttgga       240
     ttcattttaa tcgcgaaaaa aggctatttt aaggaggtga gggaagaaat ccggtga          297
//

If you have problems or comments...

PBIL Back to PBIL home page