(data stored in ACNUC10821 zone)

EMBL: AE017262.PE572

AE017262.PE572       Location/Qualifiers
FT   CDS_pept        596008..596850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0551"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03362"
FT                   /protein_id="AAT03362.1"
FT                   /translation="MTSRTVKVTTASLLALGLIVAPVLSGDFASAATFVTKDSKGIVKF
FT                   DKSTTPDPDPVNPDPVDPDPVIPDPTDPPVGTDGLWILAVSDWDFGTHNVSSLSSGALN
FT                   VHAADDTISTYVDANGNGQQDLPGEVSVTKKVTPYAQISDVRGTNTGWTLSVTGSAFKD
FT                   SSTPAKTIPGAELTIPKSTVSSATSTAQAPTGYDSVTISMTGGAAVPVMAAKDMQTATP
FT                   TNFNDDQGMGTWTDSFGSQAVSATDTSKPKLSIPKNVVVADGTYQSTLTWTLSDTPAV"
     atgacaagta gaacagtaaa agtaacaaca gcgagtttat tagcattagg tttgattgtg        60
     gcaccagtac tttctggaga ttttgcttca gctgccactt tcgtaacgaa agattccaaa       120
     gggattgtaa aatttgataa aagcaccacg ccagatccgg atccagtaaa tccagatcca       180
     gttgatccag acccagttat tccggatcca actgatccac ccgtaggtac agacggactt       240
     tggattttag ccgtatctga ctgggatttt ggtacgcata acgtttctag cttatcttca       300
     ggtgcgttaa atgtacatgc agcggatgat acgatttcta cttatgtaga cgcaaatggt       360
     aatggacaac aagatttgcc aggggaagtt tcagtaacta agaaagtaac tccttatgca       420
     caaattagtg atgttcgtgg tactaataca ggttggacac tttccgtgac gggtagtgct       480
     ttcaaagatt cttctacacc agcaaaaacg attccaggtg cagagctaac tattcccaaa       540
     tcgactgtta gttcagcgac ttctaccgct caagcgccaa ctggatatga tagcgtaaca       600
     atttcaatga ctggcggcgc agcagttcca gtaatggcag ctaaagatat gcaaacagct       660
     acaccgacca actttaacga tgaccagggg atgggcacat ggacagatag ctttggttcc       720
     caagcagtgt ccgcaacaga tacttccaaa ccaaaattat ccattccgaa aaacgtcgtt       780
     gtcgctgatg gaacttatca aagtacatta acttggactt taagcgatac accagcagtt       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page