(data stored in ACNUC10821 zone)

EMBL: AE017262.PE573

AE017262.PE573       Location/Qualifiers
FT   CDS_pept        596926..597957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06030"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03363"
FT                   /protein_id="AAT03363.1"
FT                   /translation="MKKICAIIFACVLAILCFPGQQAYATENSSFSVKAILSDNQASSV
FT                   TYFDLQMKPKQKQSLNVEITNQSKEEITVNCVANTAVTNEMGYVDYSIPNTKPDKTLKY
FT                   PFADMVKESVSEVTLKPNETKIWTAAIQMPAENYDGIILGGLHFQEKKEEDKEKDSSEN
FT                   DVQIKNEYAYVIGVKLTEKTTVVKPELELNQIKPATRNYRNVVEMNLQNTKATLVGGLA
FT                   VDAKIYKKGSEKVLHESKRTDLSMAPNSNFNYSVDWENQELKPGKYKVHLVAKNKEDKW
FT                   EWTKEFTISSDQAKKANKVALGLEKDYTWMYIVGGVLLFILLIIATYFVGKRAAKKKQE
FT                   NEK"
     ttgaaaaaaa tatgcgctat catctttgct tgtgtactag ctattctttg ttttccagga        60
     cagcaggcgt acgcaacaga aaatagtagt ttttccgtaa aagcaattct ctctgacaat       120
     caggcatcta gtgtgaccta tttcgattta caaatgaaac caaagcaaaa acaaagttta       180
     aatgtagaaa ttacgaacca gagtaaagaa gaaatcaccg ttaattgcgt tgccaataca       240
     gccgttacca atgagatggg ctacgtggat tattccatac caaatacgaa accagataaa       300
     acgttaaaat acccctttgc agatatggtg aaggaaagtg tctctgaggt tacacttaag       360
     ccaaacgaaa ccaaaatttg gacagcggct attcaaatgc ccgctgaaaa ctacgacggt       420
     attattttag gaggattaca ttttcaagaa aagaaagagg aggataaaga aaaagactcc       480
     agcgaaaacg atgtccaaat taaaaatgaa tacgcctacg tcattggtgt caaattaacc       540
     gaaaaaacga ccgtcgtaaa gccagaatta gaattaaatc aaattaaacc agcgaccaga       600
     aattaccgaa atgtagtaga aatgaatttg caaaatacaa aagcgacctt agttggtgga       660
     ctggccgtgg atgcaaaaat atataagaaa ggcagcgaaa aagttttaca tgaatcaaaa       720
     cgcacagatt tatccatggc gccaaattcc aattttaatt atagtgtaga ttgggaaaat       780
     caagagttaa aaccaggtaa atataaagtg catttagttg ctaagaacaa agaagataaa       840
     tgggagtgga caaaagaatt cactatctct tctgatcaag caaaaaaagc caataaagta       900
     gctcttggac tggagaaaga ctacacgtgg atgtatatcg taggtggagt attgcttttc       960
     attcttctta ttatcgcaac ttactttgtc ggcaaacgag cagcaaagaa aaaacaggaa      1020
     aatgaaaaat ag                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page