(data stored in ACNUC10821 zone)

EMBL: AE017262.PE576

AE017262.PE576       Location/Qualifiers
FT   CDS_pept        600130..601608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0584"
FT                   /product="proton-dependent oligopeptide transporter"
FT                   /note="identified by similarity to SP:P36574; match to
FT                   protein family HMM PF00854; match to protein family HMM
FT                   PF07690; match to protein family HMM TIGR00924"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03366"
FT                   /protein_id="AAT03366.1"
FT                   /translation="MSTKKEKTFFGHPRGLATLFNTEFWERFSYYGMRALLLYYMYTAV
FT                   ADGGLGFSQSTATAIMSIYGSLVFMSGVIGGWFADRVLGARQTIFYGGVLIMVGHIVLA
FT                   LPNGGAAALFGSMAFIILGTGLLKPNVSNVVGDLYPAGDNRRDAGFSIFYMGINLGAFI
FT                   APPIVSAVSDNAGSFHAGFGVAAVGMAIALVVYVLTGKRYLKDAGKKAPNPLQRSEAKS
FT                   LTFKIIGIVLGIGLLIAVLTLITGSLTIDTIILAVTVMGVGVPLAYFIMMMTSKKTEAD
FT                   EKSRLTAYIPLFLIAVLFWMIEEQGSSTLALFAAERTDLSIWGMNLNPANFQSLNPVFV
FT                   ITLSPIFAWIWTKLGDRQPSTPRKFALGLFFAGLSFVVMMLPGILHGNTTTLVSPLWLV
FT                   LSFFICIFGEMFISPVGLSATTKLAPKAFASQTMSLWFLSDAMGQSFNAQLTQLFNADT
FT                   EIAYFGITGFVAIAFAVALFIFAPFLKKYMKGVH"
     ttgagtacca agaaggaaaa gacgtttttc ggccatccgc gcggcctagc tacattattt        60
     aacaccgaat tttgggagcg attctcctat tacggaatgc gtgcattatt actttattat       120
     atgtatactg cagtagcaga tggtggactt gggtttagcc agtctaccgc aacagcaatt       180
     atgtctattt atggttcact agtatttatg tcaggagtca ttggtggatg gttcgctgac       240
     cgtgtcttgg gggcacgaca gaccattttt tacggtggag tccttattat ggtggggcat       300
     attgtactag ctttaccaaa tggaggagca gcggcattat ttggttcgat ggcatttata       360
     attctcggaa ctgggctact taaaccgaat gtttctaatg tcgttggcga tttataccca       420
     gctggcgata atcgtcgtga tgctggtttt agtatcttct acatggggat taacttaggt       480
     gcatttattg ccccgcctat tgtttcggca gtttctgata atgctggaag tttccatgct       540
     ggttttggtg tggcagctgt tggtatggca attgcacttg ttgtttatgt tcttacagga       600
     aaacgttact taaaagacgc tggcaaaaaa gcgccaaatc cgcttcaaag atcagaagca       660
     aaaagtctta cattcaaaat aattggcatt gttttaggca taggattatt aattgctgtt       720
     ttaacactaa ttacaggtag cttaacaatt gatacgatta tccttgctgt aacggtgatg       780
     ggcgtggggg ttccactcgc ttactttatt atgatgatga ctagcaagaa aaccgaggcg       840
     gacgaaaaat cacgattaac tgcatacata ccgttatttt taattgctgt actattttgg       900
     atgattgaag aacaaggctc gtccacattg gcgcttttcg cggcagaaag aacggattta       960
     tctatttggg gtatgaactt aaatccggcc aatttccagt cgcttaaccc agtgtttgtt      1020
     attacacttt cgccaatttt cgcatggatt tggacgaaac ttggtgatag acaaccatct      1080
     acaccacgta aatttgccct tggactattc ttcgctggtt tatctttcgt tgttatgatg      1140
     cttccgggta tcttgcacgg aaacacaaca acgcttgtaa gtccactttg gttagtacta      1200
     agtttcttca tctgtatttt cggtgaaatg tttatctcac cagtcggatt atctgcgact      1260
     accaaactag cgccaaaagc ttttgcttca caaacgatga gcttatggtt cttgtcagat      1320
     gcaatggggc aatcatttaa cgcacaatta acacaattat ttaatgctga cactgaaatt      1380
     gcttatttcg gtattactgg ttttgtagca attgcttttg cggtagcatt attcattttc      1440
     gcgccattct tgaaaaaata tatgaagggc gttcattaa                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page