(data stored in ACNUC10821 zone)

EMBL: AE017262.PE579

AE017262.PE579       Location/Qualifiers
FT   CDS_pept        complement(603182..604222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0563"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03369"
FT                   /protein_id="AAT03369.1"
FT                   /translation="MSKNQATAYIGTYTKAESQGIYRLVIDKTTGEIKENKLAGKMDNP
FT                   TYLKISDDEKFVYSVAKDGDKGGVAAFSVEEDGSLTFINQDVQTGNPPCYVDASHDGSI
FT                   VVSANYHLGTIVSYPTENGALKPSVSTIQHTGKSVHERQEKPHAHFAGFTPDQKYVITC
FT                   DLGTDKVTTYSATAGKLEKVTELDVKPGSGPRNLVFHPNAKYVYIMTELTSEVIFAEYD
FT                   EATGALNVIQTIASLPEGFDKENKGSAIHISPDGRFLYVSNRGQDAIVSYAVAENGTLT
FT                   LAATTPVEGVGPRDFDLSYTGEILVATNENSNNVTVFGVNKETGALTLLQKDVKVPEPV
FT                   CIKFVK"
     atgtcaaaaa atcaagcaac tgcttatatc ggtacatata ccaaagccga gagccaaggt        60
     atctatcgct tagtaatcga caaaactacc ggcgaaatca aagaaaataa attagctgga       120
     aaaatggaca atccaacata tcttaaaatt tcagatgacg aaaaattcgt ttattctgta       180
     gcaaaagatg gcgataaagg tggggttgca gctttttctg tggaagaaga cggttcgctt       240
     actttcatta atcaagatgt tcaaacaggt aacccaccat gttacgtaga tgcctctcat       300
     gacggttcta tcgttgtatc tgcaaactat cacttaggca caatcgtaag ctatccaaca       360
     gaaaatggtg cattaaagcc ttctgtttct accattcaac atactggtaa aagtgttcac       420
     gaacgccaag aaaaaccaca cgcgcacttt gcaggattca caccagacca aaaatacgtt       480
     atcacatgtg accttggaac agacaaagta acgacttatt ccgctactgc tggcaaactt       540
     gaaaaagtaa ctgagctaga cgtaaaacct ggaagcggtc ctcgtaacct agtcttccat       600
     ccaaatgcta aatatgtgta catcatgaca gaattaactt ccgaagttat ttttgctgaa       660
     tatgatgaag ctactggcgc attaaacgtg attcaaacaa tcgcttctct tccagaaggt       720
     tttgacaaag aaaataaagg tagcgctatc catatttctc ctgatggtcg tttcctatat       780
     gtgtcaaatc gtggccaaga tgccatcgtt agttatgcag ttgccgaaaa cggcacacta       840
     acacttgcag caacaacacc agtagaaggc gtaggtccac gtgacttcga cctgagctac       900
     actggcgaaa tcttagttgc aacaaacgaa aacagcaata acgttactgt ttttggtgtt       960
     aacaaagaaa ctggtgcact tacattactt caaaaagatg taaaagttcc tgaaccagtt      1020
     tgtattaaat tcgtaaaata a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page