(data stored in ACNUC10821 zone)

EMBL: AE017262.PE590

AE017262.PE590       Location/Qualifiers
FT   CDS_pept        complement(612644..613822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0598"
FT                   /product="putative ATP phosphoribosyltransferase regulatory
FT                   subunit"
FT                   /note="identified by similarity to SP:O34459; match to
FT                   protein family HMM PF00587"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03380"
FT                   /db_xref="GOA:Q722Y1"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y1"
FT                   /protein_id="AAT03380.1"
FT                   /translation="MNLNKNLPTGTRDKLFREAQAAYKIEQQVNHYFEKRGFKRIETPV
FT                   IEFEDVFSSEHQADAKLYRFFDEKGRLTVLRPDMTLPIGRVVSTTGVMLPLKLSYSGKI
FT                   FRANEDFGGEQNEQTQAGIEIIGYPSIKAEIECILSGIGVLNALEIPNFQIELGHAAIY
FT                   RRVIQLLNLSETAEIDFRQLIQNKSLTGIKRFVANNPSTLDDFILAIPRLFGPATAILN
FT                   QAKSLTTDKGILTALREMETIVEAVSYTADISVDLGLVQDFHYYTGIIFRGYADLAADN
FT                   FLSGGRYDHLLEQFTSSSSPAVGLALNLDSLTTLQNRAGIIKKQTPTTLLIHYDLEALP
FT                   QAEKFMQETPNSELSFFETASNAISFAKKWHIPEVVHVSSQGIQTILQREVD"
     atgaacttaa ataagaactt accaaccgga acacgtgata aactctttcg tgaagcacaa        60
     gctgcataca aaattgagca acaagtgaat cattattttg aaaaacgtgg atttaaacgt       120
     attgaaacac ctgttatcga gtttgaagat gtcttttctt ctgaacatca agccgatgcg       180
     aagttatacc gtttctttga cgaaaaagga cgtttgacag ttctacgtcc ggacatgacc       240
     cttccaattg gtcgagttgt gagtacaact ggtgtgatgc tccctctaaa actttcttat       300
     agcggaaaaa tttttcgtgc caatgaagat tttggtggcg aacaaaacga acaaacgcaa       360
     gctggaattg aaatcattgg ctatccttcg attaaagcag agattgaatg tattttaagt       420
     ggaatcgggg ttttaaatgc tctagaaatt ccgaattttc aaattgaact cggacatgca       480
     gcaatttatc gtcgtgttat ccaactttta aatctctccg aaacagctga aattgatttt       540
     cgccaactaa ttcaaaataa aagcttaact ggtattaaac gatttgttgc caataatcca       600
     agtacacttg acgattttat tttagccata ccaagattat ttggcccagc gacagctatt       660
     ttaaaccaag caaaaagttt aacgactgac aaaggaattt taacggcact gcgcgaaatg       720
     gaaaccattg tggaagctgt ttcttacaca gcagatatta gtgtcgattt aggactcgta       780
     caagattttc attattatac aggtataatt tttagaggat acgctgacct tgctgctgat       840
     aattttttaa gcggcggccg ttacgatcac ctactagaac aattcaccag ctcttcctcc       900
     ccagcagttg gtttggctct taatctcgac tccctcacaa ctctacaaaa ccgcgctggc       960
     atcatcaaaa aacaaacgcc aacaactctt ttgatccact acgaccttga agcactccca      1020
     caagcagaaa aattcatgca agaaacacca aatagtgaat taagtttttt tgaaacagca      1080
     tcaaacgcca tctcttttgc aaaaaaatgg catattcccg aagtcgttca cgtctcgagc      1140
     caaggcatcc aaactatttt acaaagggag gtggactga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page