(data stored in ACNUC10821 zone)

EMBL: AE017262.PE593

AE017262.PE593       Location/Qualifiers
FT   CDS_pept        615159..616190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0577"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03383"
FT                   /protein_id="AAT03383.1"
FT                   /translation="MPDFSYAKITKLVVHFAGNKAREEGTEVSANVLADIGSEMNQTLA
FT                   SIFLEPFNKDEYYQFTHETDLDFNEVRTFAANMFVAEDEFLDESKKILEHLYSETTHPN
FT                   IKSGDVWIFFIEGCVVDGDFTNGIGIFKVENKEVFLKNDFNGREFQIGYDKGITGTDLD
FT                   KGCLVFNVDHDTGNKVLILDRLNRGDSVYWKDKFLSIDKITDEKFYTEGFVEVCTDYIK
FT                   QREESLLDKSNFVKATSEYLAGEETLNIAEFARTTIEKPEEITEFNTMVDTFERENNVR
FT                   FPETFQLDEEKREKLSKKIRKTIKLGKNISVVVKDLEQLEETDFVQGYDEEKGKNYMIV
FT                   YYD"
     atgccagatt tttcatacgc aaaaattact aaactcgtgg tccattttgc tggaaataaa        60
     gcgagagaag aaggaacaga agtatcagcg aatgtgctcg ctgacattgg ctcggaaatg       120
     aatcaaacac tagcttcgat tttcttagag ccatttaata aagatgaata ttatcaattt       180
     acgcatgaaa cagatttgga ttttaatgaa gttcgtactt ttgctgcgaa tatgtttgtc       240
     gcggaggacg agtttctgga tgaatccaag aagattttag agcatttata tagcgaaaca       300
     acccacccga atattaaaag tggcgatgtt tggattttct ttattgaggg ctgcgttgtc       360
     gatggtgatt tcacgaacgg aatcgggatt tttaaagtcg aaaacaaaga agtttttctt       420
     aaaaatgatt tcaatggcag agaattccaa attggctatg ataaagggat taccgggacg       480
     gatttagata aaggttgctt ggttttcaat gtggatcatg acacgggaaa taaagtgttg       540
     attttagacc ggcttaaccg cggcgattcg gtttattgga aagataagtt tttgagtatt       600
     gataagataa ccgatgagaa attttacacg gaaggttttg tggaagtttg tacggattat       660
     attaaacaac gcgaggaatc actgcttgat aaatctaatt ttgtaaaagc gacatcggaa       720
     tatttagcag gagaagagac gttgaatatt gctgaatttg ctcgcacgac aattgaaaaa       780
     ccggaagaga ttaccgaatt caatacaatg gtggatacgt tcgaacgaga aaacaatgtc       840
     cgttttccag aaacattcca attagatgaa gaaaagcgcg aaaaactatc gaaaaaaata       900
     cgtaaaacga ttaagcttgg caaaaatatt tcggttgttg tgaaagattt agaacagctg       960
     gaagaaactg attttgtaca aggatacgac gaggaaaaag gcaaaaacta tatgattgtg      1020
     tattatgatt aa                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page