(data stored in ACNUC10821 zone)

EMBL: AE017262.PE594

AE017262.PE594       Location/Qualifiers
FT   CDS_pept        complement(616233..617528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0602"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03384"
FT                   /protein_id="AAT03384.1"
FT                   /translation="MDKFFKLRENKTTVRTEILAGLTTFLSMAYVLFVNPSMLATTGME
FT                   LKAVFVATILASVVGSLAMGLIANYPIGLAPGMGLNAFFAYTVCAQWGIPWQTALAGVL
FT                   VSGLVFICLTISGLREKIVNAIPTELKFAVGAGIGFFIAFLGLKNAGIIVPNESTIVAL
FT                   GDLHSGPVLLAVFGIVVTVAYMTIGWKGAIFFGMATTAVAGMLFGLIDVPTQVVSSVPS
FT                   MESTFGQAIIHLPDIFTPQMLIVILTFFFIDFFDTAGTLVAVATQAGFVKDNKIPRAGR
FT                   SLFSDSLATVFGAIFGTSTTTSYVESTAGVAVGGRTGLTAVVIAICFSLSLFFSPLLGV
FT                   ITSAVTTPALVIVGILMIGNVAHIDWTKFEVAVPSFFVILMMVLTFSIATGIAIGFIFY
FT                   PITMVLKGRYKEVHPIMYVMMVLFILYFMFVV"
     atggataaat ttttcaaact acgcgagaac aagacgactg ttcgaacaga aatactcgcg        60
     gggctaacga ctttcttatc gatggcttat gtacttttcg tcaacccatc tatgcttgca       120
     acaactggaa tggaattaaa agctgttttt gtggcgacga ttcttgcttc tgttgtagga       180
     tcgcttgcaa tgggactaat cgctaattac ccgattggac ttgcaccagg tatgggacta       240
     aatgcgtttt tcgcttatac cgtttgtgcg cagtggggaa ttccttggca aacggcgctg       300
     gctggtgttc tcgtttctgg cttagtgttc atttgtttaa ctatttctgg acttcgcgaa       360
     aaaatcgtta atgcaatccc aacggaacta aaattcgcag tgggagcagg tattggtttt       420
     tttatcgcct ttttagggct taaaaatgct ggaattattg tgccaaatga atctactatt       480
     gtagcgcttg gtgacttaca ttctggccca gtgttactgg ctgttttcgg gattgttgtt       540
     actgttgctt acatgacaat tggttggaaa ggtgcgattt tctttggaat ggcaacaacc       600
     gctgttgctg gaatgttgtt tggactgatt gatgtgccga ctcaagttgt ttcatctgta       660
     ccaagtatgg agtcaacgtt tggtcaagca attattcact taccagatat ttttacacca       720
     caaatgctca ttgttatttt gacatttttc ttcattgatt tttttgatac tgccgggaca       780
     cttgttgcgg ttgcgactca agctggattt gtaaaagata acaaaattcc gcgcgcaggt       840
     cgttcgctat tctcggattc acttgcaaca gtatttggag cgattttcgg gacttcaaca       900
     acgacttctt atgtagaatc tactgctggg gttgctgttg gtggtcggac aggtttaact       960
     gccgttgtta tcgcaatctg tttctcactt tcactattct tctcgccgct tcttggcgta      1020
     attacaagtg cggttacgac tccagcgctt gtcattgttg ggattttaat gattggaaat      1080
     gtcgctcata ttgattggac taaattcgaa gtagctgttc cgtccttttt cgttatttta      1140
     atgatggtac tgactttctc tatcgctact ggtatcgcaa ttggtttcat tttctatcca      1200
     atcaccatgg tacttaaagg acgctacaaa gaagtgcatc cgattatgta cgtgatgatg      1260
     gtactgttta tactgtactt tatgttcgtc gtttag                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page