(data stored in ACNUC10821 zone)

EMBL: AE017262.PE595

AE017262.PE595       Location/Qualifiers
FT   CDS_pept        617844..619238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0603"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03385"
FT                   /protein_id="AAT03385.1"
FT                   /translation="MTYKFPENFWWGSAASGPQTEGAANVDGRKPSIWDHWYKIEPGRF
FT                   FNDVGPTNTSNFYYQYKEDIALMKQTGHNSFRTSIQWSRLIPDGIGEVNPKAVDFYNRV
FT                   IDEMLANDVEPFMNLYHFDMPMSMQEKGGFESREVVDAYATFAKTCFELFGDRVKHWFT
FT                   FNEPIVPVEAGYLYDMHYPNVVDFKRATQVAYHTTLAHALAVKEFHALEIPEGQIGIIL
FT                   NLTPSYPRSQNPADLKAAHIADLIFNRSFLDPVTKGEFPADLVEIIREHDALPEYTEED
FT                   LAIIKNNIIDILGVNYYQPRRVKAKEYAAHPDAPFMPEHLFDNYEMPYRKMNPYRGWEI
FT                   FERAIYDIAINLRDNYDNIPFFISENGMGVEGESRYRNADGMIEDTYRIDFIKSHLKWL
FT                   HKAIEEGSNCHGYHLWTFMDCWSWANAYKNRYGLVEVDLDNNFKRTIKASGHWYKELSE
FT                   NNGFED"
     atgacttata aatttccaga gaatttttgg tggggaagtg cggcgtccgg cccacaaaca        60
     gaaggcgcag caaatgtaga tggcagaaaa ccgagtattt gggatcactg gtacaaaatc       120
     gaaccaggtc gtttctttaa cgatgtagga cctacgaata catctaattt ttactatcaa       180
     tataaagaag atattgcttt aatgaaacaa actgggcata attctttccg tacttcgatt       240
     cagtggtcac gtcttattcc agatggtatt ggcgaagtga atccgaaagc ggttgatttt       300
     tacaatcgcg ttattgatga aatgcttgca aatgacgtgg aaccatttat gaatttatat       360
     cattttgata tgccaatgtc gatgcaagaa aaaggcggtt ttgaaagccg tgaagtagtt       420
     gacgcgtatg caacttttgc gaaaacatgt tttgaattat tcggagatcg tgtgaaacat       480
     tggtttactt ttaatgaacc aattgttcct gttgaagcag gttacttata cgatatgcac       540
     tatccgaatg tcgttgattt taaacgtgcg actcaggttg cttaccatac tactttggca       600
     catgcgcttg ctgttaaaga attccacgca cttgaaattc cagaaggcca aatcggaatc       660
     attttaaact taacgccgtc gtatccaaga agccaaaatc cagctgattt aaaagcggct       720
     catattgcag atctaatttt caaccgtagt ttccttgatc cggttacaaa aggggaattc       780
     ccagctgacc ttgttgaaat tattcgcgaa catgacgcgc ttccagaata tactgaagaa       840
     gatttggcga taattaaaaa caacattatt gatattcttg gtgtaaacta ctaccaaccg       900
     cgtcgtgtga aagcgaaaga atacgcagct catccggatg caccatttat gccagaacat       960
     ctttttgata actatgaaat gccttaccgc aaaatgaatc catatcgtgg ttgggaaatt      1020
     ttcgaaagag cgatttatga tattgcgatt aatctgcgtg ataactacga taatattcca      1080
     ttcttcattt ctgaaaatgg tatgggtgta gaaggcgaaa gtcgctaccg taatgcagac      1140
     ggaatgattg aagatacgta ccgaatcgat ttcattaaga gtcacttgaa atggctgcat      1200
     aaagccattg aagaaggttc taactgtcat ggttatcatc tttggacatt catggattgc      1260
     tggagctggg cgaatgctta caaaaaccgt tatggcttag tagaagttga tttagacaat      1320
     aatttcaaac gtactataaa agcatccgga cattggtaca aagaactttc agaaaacaat      1380
     ggttttgaag actaa                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page