(data stored in ACNUC10821 zone)

EMBL: AE017262.PE598

AE017262.PE598       Location/Qualifiers
FT   CDS_pept        complement(621977..622435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0606"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:SA0807"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03388"
FT                   /protein_id="AAT03388.1"
FT                   /translation="MDLVWTIIIQLVLSYVATVTFAIITNVPKRALNACGITGTFGWMA
FT                   YWTLMQMDSGTGASSLAGAFVVAVLSHFFAKYKKLPITIFNVPGIVPLVPGGLAYQAVR
FT                   NFVLGDYTEAIGFSVQVTVVAGAIAAGLMLSEVFNHSIRTFRERKERI"
     atggatttag tttggactat tattattcaa ttagtgctaa gttacgttgc gacggtgacg        60
     tttgcgatta ttacaaacgt tccgaaaaga gcgttgaatg cttgtggtat taccggaaca       120
     tttggctgga tggcttattg gactttaatg caaatggact ctggaacagg cgcatcctct       180
     ctagcagggg ctttcgtcgt cgctgtactc agtcactttt ttgcgaaata taagaaattg       240
     ccaattacga tttttaatgt tccgggaatt gtcccgctcg ttcctggggg acttgcttac       300
     caagctgtgc gtaattttgt attaggtgat tatacggaag caattggctt ttctgtgcaa       360
     gtaacagtcg ttgctggcgc gattgccgct ggattaatgt tatcagaggt tttcaatcat       420
     agtattagaa cattccgtga gcgtaaagaa cgtatttga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page