(data stored in ACNUC10821 zone)

EMBL: AE017262.PE599

AE017262.PE599       Location/Qualifiers
FT   CDS_pept        complement(622449..623201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0583; match
FT                   to protein family HMM PF06738"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03389"
FT                   /protein_id="AAT03389.1"
FT                   /translation="MSTETTDYLLETCLMAGKIMMESGAEMYRVEDTMNRIATIASNKK
FT                   GISFVTPTGLFMSLEGERNVQLQQIPTRTINLEKVSMVNEFSRDFAEKRISLKELHTKL
FT                   VNLDKDVRYFPIWLQIIAASLVSGSLMVIFGGGWFDFIPTCIIGAIGFIIFYYTQIFMK
FT                   VKFLAEFLASLSVGLLAVLTISIGWGINLDTMIIGGVMPLVPGVPITNAVRDLIAGHLL
FT                   SGMARGTEALLTSCAIGIGIAVVFRFFL"
     atgtcgactg aaacaacaga ttatttgcta gaaacatgct taatggcagg caaaataatg        60
     atggaaagtg gcgctgaaat gtatcgcgtg gaagatacaa tgaaccgcat tgcaaccatc       120
     gctagtaata aaaaagggat tagtttcgtg acgccaactg ggctttttat gtcacttgaa       180
     ggtgagcgta atgtacaatt acagcaaatt cccacaagaa ccattaattt agaaaaagta       240
     tctatggtca atgaattttc cagggatttc gcggaaaaga gaatttcctt aaaagaatta       300
     catacaaagc tcgttaattt agataaagat gttcgctact ttcctatttg gttgcagatt       360
     attgcggcat cactcgttag tggatcgttg atggttattt ttggcggggg ttggtttgat       420
     tttattccga cttgtatcat tggcgctatt ggttttatta ttttttacta cacgcagatt       480
     tttatgaagg tgaagtttct agcagaattt ttagcttcat taagtgtcgg gctcttagct       540
     gttttgacga tttcgattgg ttggggtatt aatctggaca cgatgattat cggtggcgtg       600
     atgccgcttg ttcccggggt gccgattacg aatgcggttc gggatttgat tgctgggcat       660
     ttgcttagtg gaatggcacg tggaacagaa gcgctactta cttcttgtgc aataggaatt       720
     ggaatcgcgg ttgttttccg ctttttctta taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page