(data stored in ACNUC10821 zone)

EMBL: AE017262.PE600

AE017262.PE600       Location/Qualifiers
FT   CDS_pept        623330..623575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16413028"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03390"
FT                   /protein_id="AAT03390.1"
FT                   /translation="MVDIESERIRIILANIEYEIIEEIGVLSENARGWRKELNKISWNG
FT                   RPPKYDIRDWSEDHEKMGKGITLTDEEAEVLKKLLD"
     atggtagata tagaatcaga aaggataagg attattttgg cgaatattga atatgaaatc        60
     atcgaagaaa ttggcgtatt atctgaaaat gcgcgtggtt ggcggaagga attaaacaaa       120
     atcagctgga acggccgccc acctaaatac gatatccgcg actggtcaga agatcatgag       180
     aaaatgggaa aagggattac actaactgat gaagaagcag aagtactaaa aaaactgtta       240
     gattga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page