(data stored in ACNUC10821 zone)

EMBL: AE017262.PE602

AE017262.PE602       Location/Qualifiers
FT   CDS_pept        complement(624284..625468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0586"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03392"
FT                   /protein_id="AAT03392.1"
FT                   /translation="MKNLVKVKVFPKFTKGYKEGYPLILKERMEKWPKELQEGDVLELT
FT                   DTNGQFIARGYHGEQNKGSGWLFTWDKKQQLDEDFLTNLITTAIEKRQFLFADDSTTAF
FT                   RIFNGEGDGLGGFTVDFYDDYLVIQWYSLGIYAFQKMIIDIFLSFPEIKGIYEKRRFQE
FT                   DTKDDFVAGQKATFPLIIKENGINYATYLDDGWMTGIFLDQRDVRRRISEDYSVSKNVL
FT                   NTFSYTGAFSVAALFGGASKTTSVDVAGRSLSKTKEQLEVNGLDPNEQAIIVEDVFHYF
FT                   KYAARKQLTFDLVVVDPPSFARTKKVTFRAAKDYPAMLREIIDITAPNGTIIASTNYAG
FT                   FGMKAFKKLIAEAFQTSDRTYKIVETHSLPADFTVNKNFPEGNYLKVLFLTLDI"
     atgaagaatc tagtaaaagt aaaagttttt cctaagttca caaaaggcta taaggaaggt        60
     tatcccctta ttcttaaaga gcgtatggaa aaatggccaa aagaattaca agaaggcgac       120
     gtattagaat taacagatac gaatggtcaa tttattgcaa gaggctacca cggagaacaa       180
     aacaaaggca gcggctggct tttcacttgg gacaagaaac agcaactcga tgaagacttt       240
     ttaacgaacc taattacgac agcaatcgaa aaacgtcaat ttctatttgc agatgactct       300
     actactgctt ttcggatttt taatggcgaa ggagatggac ttggtggttt cactgttgat       360
     ttttatgatg attatctcgt aattcaatgg tacagtctag gcatctacgc tttccaaaaa       420
     atgattattg atattttctt atcttttcca gaaataaaag gtatttatga aaaaagacgt       480
     tttcaagaag atacaaaaga cgatttcgtc gccggtcaaa aagcaacttt cccacttatt       540
     attaaagaaa atggcattaa ttatgcaact tatttagatg atggttggat gacaggtatc       600
     tttctagatc aacgggatgt gcggagaaga attagtgagg attattctgt ttcaaaaaat       660
     gtcttaaata cattttcgta tacaggggca ttctcggtag cagctttatt tggtggcgcg       720
     agtaaaacga caagcgtaga tgtggctggt cgttcgctca gcaagacaaa agaacaatta       780
     gaagtaaatg gtcttgatcc aaacgagcaa gcgattatcg tagaagatgt tttccattat       840
     ttcaaatatg cagcgcgcaa acaattaact tttgatttag ttgttgttga tcccccaagc       900
     tttgcacgca caaaaaaagt aactttccga gcggcgaaag attaccctgc tatgcttcgt       960
     gaaatcattg acatcactgc tccaaacggc accatcattg cttcaacaaa ttatgcagga      1020
     ttcggtatga aagcatttaa aaaattaatt gcggaggcct tccaaacaag cgaccgtact      1080
     tataaaattg ttgaaactca ttccttaccc gcagatttca cggtaaataa aaactttcct      1140
     gaggggaatt atttaaaagt gctctttctt actttagata tctaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page