(data stored in ACNUC10821 zone)

EMBL: AE017262.PE604

AE017262.PE604       Location/Qualifiers
FT   CDS_pept        627408..629738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0612"
FT                   /product="putative preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF01043; match to protein
FT                   family HMM PF07516; match to protein family HMM PF07517"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03394"
FT                   /db_xref="GOA:Q722W7"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722W7"
FT                   /protein_id="AAT03394.1"
FT                   /translation="MRQNYDDRKIVKQYREIARQIVKKEGLYKNMDQAELCEQTNFWRE
FT                   KFKTKPMTDRDKINIFALAREAASRIIGLDAVVVQLIGALVLGDGKVAEMKTGEGKTLM
FT                   SLFVMFIEVMRGNRVHLVTANEYLARRDREEIGQVLEYLGVSVALNESGLDIAQKKAIY
FT                   TADVIYGTASEFGFDYLRDNMVRQKEDKVQSGLDFVLIDEADSILIDEARTPLLISDRK
FT                   EEDLSLYHTANKLVKKMMKDDYEMEEHKRFVWLNDAGIEKAQKFWGVESLYSAEAQSEL
FT                   RITMLLMRAHFLMHKDKDYVVLDDEVLIIDPHTGRALPGRRFNDGLHQAIEAKEGVEVK
FT                   EESRTLATITIQNYFRMYKKISGMTGTAKTEEEEFRQIYNMDVVVIPTNLRVNREDMQD
FT                   DIFYTKKEKGRAIVYEVSWRYEKGQPTLIGTSSIKSNEWISGLLDAAGIPHQVLNAKNH
FT                   AQEAEIIAKAGKRGMVTLATNMAGRGTDIKLDPDVHKLGGLAVIGTERHESRRIDLQLM
FT                   GRSGRRGDPGFSKFMISLEDDLLEQFESKSWEKLSTKLKRKAPRDGKPVNSRKIHAVVV
FT                   DAQKRLEGANYDIRKDLLSYDEVIDLQRKMVYKERDLLLERNKLGVSSEKILREVAEYS
FT                   FIHPSDIPEEELEIYYSRQKELLGGTKFPISFDQVTLMDPREVVEEIVSWHKKERNKFP
FT                   AETIAAIEREVYLNLMDQMWVMHLDAMVQLREGIHLRAYGQQDPLVMYQKEGAQLFEKF
FT                   QADYHFYFAHALLELDPDGLIQG"
     atgagacaaa attatgatga tcgaaaaata gtgaaacagt atcgagaaat agcccgtcaa        60
     attgtaaaaa aagagggctt atataaaaat atggatcagg ctgaactttg tgaacaaact       120
     aatttttggc gcgagaagtt taagacaaaa ccgatgactg atcgagataa aattaatatt       180
     tttgctttgg cgagagaagc agctagccga attattggtt tggatgcggt tgtagtgcaa       240
     ttaataggag cgctcgttct cggcgatggc aaagtggcag aaatgaaaac cggcgagggt       300
     aaaacattga tgtcgttatt tgttatgttt atagaagtaa tgcgtggtaa tcgtgtacac       360
     cttgtgactg ccaatgagta tttagctaga cgtgaccggg aagaaattgg acaagtgctg       420
     gaatatcttg gtgtttccgt tgcgttaaat gaatctggtt tagacatagc ccaaaaaaag       480
     gccatttata cagcagatgt tatttatgga acggcttctg aatttggttt tgattactta       540
     cgcgacaata tggtacgcca aaaagaagat aaagtacaaa gtggacttga ttttgtttta       600
     atagatgaag cagattcaat tttaatagat gaagcgagaa cgcccctact gatttctgac       660
     cgtaaagaag aagatttgtc cctttatcat acagcgaata agcttgtgaa gaagatgatg       720
     aaagatgatt atgagatgga agaacataaa cgctttgttt ggttgaatga tgctggaatt       780
     gagaaagccc agaagttttg gggtgtcgaa tcactttatt ccgcagaggc gcagtcagaa       840
     cttagaatta cgatgctttt aatgcgagct catttcttga tgcataaaga taaagattat       900
     gtggtgcttg atgatgaagt attaattatc gatccacata ctggtcgtgc gcttccaggc       960
     cggcgcttta atgacggact ccatcaggca atcgaagcaa aagagggcgt ggaagttaaa      1020
     gaagaatcac gtacgctagc aacaattaca attcaaaact acttccggat gtataagaaa      1080
     atttctggaa tgacaggaac ggctaaaacc gaagaagaag aattccgtca aatttataac      1140
     atggatgtcg tagtaatccc caccaattta cgtgtaaatc gggaagatat gcaagatgat      1200
     attttctata cgaaaaagga aaaaggtcgt gcgattgtgt atgaagtatc atggcgctat      1260
     gaaaaaggac agccaacttt aataggaact tcttctatta aaagtaatga atggatcagt      1320
     ggcttattag acgctgctgg aattccccac caagtattaa atgcgaaaaa ccatgcccaa      1380
     gaagcggaaa taattgccaa agctgggaaa cgcggaatgg taactttagc aacgaacatg      1440
     gctggtcggg ggacagatat caagctggat ccagatgtac ataagcttgg cggactagct      1500
     gtaattggaa cggagcgcca tgagagccgt cggatagatc tacagctaat gggacgttct      1560
     ggacgacggg gtgaccctgg tttcagtaag tttatgattt ctttagaaga tgatttatta      1620
     gaacaatttg aaagtaagag ctgggagaaa ctttccacga aacttaaacg caaagcacca      1680
     cgtgatggga aaccagttaa ttcaaggaaa attcatgctg tcgttgtgga tgcacaaaaa      1740
     cgcctagaag gagcaaacta cgatattcgt aaagatttgc tttcctacga tgaagtaatc      1800
     gatttacaac gcaaaatggt atataaagaa cgcgatttat tattagaaag aaataaactt      1860
     ggagtctctt ccgaaaaaat tctacgtgaa gttgccgaat attcatttat ccatccaagt      1920
     gatattccgg aagaagagtt agaaatttat tattcacgtc aaaaagaatt gctcggcggc      1980
     acgaaattcc ctatttcttt tgatcaagta acgctgatgg atccgagaga agtggtagaa      2040
     gaaatcgtat cttggcataa aaaagaacgc aataaattcc cagctgagac gattgctgca      2100
     atagaacgag aagtttattt gaatttaatg gaccaaatgt gggttatgca tctggacgca      2160
     atggtacaat tacgcgaagg tatccacttg cgagcatatg gacaacaaga tccattagtt      2220
     atgtaccaaa aagaaggggc tcaattattt gagaaattcc aagcagacta tcatttctac      2280
     tttgctcacg ccttacttga acttgatcca gacggcttaa tccaaggcta a               2331
//

If you have problems or comments...

PBIL Back to PBIL home page