(data stored in ACNUC10821 zone)

EMBL: AE017262.PE606

AE017262.PE606       Location/Qualifiers
FT   CDS_pept        631284..631997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0590"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03396"
FT                   /protein_id="AAT03396.1"
FT                   /translation="MIIKKTLIVGLIGISSVTLFAPAAFAVTSEGDSKATVKFKAGTGV
FT                   VNPVDPENPTKPIDPLDPSNPTDPGTGNTGSLTLDYVSSVNFGEHEVSSTEQSYSSTSR
FT                   KPFIQISDRRGTGAGWKVTATATAFQNEDGAASLSGATLSFKNGETASASNTATTPTAA
FT                   QTVELPTDGTSIVSVVSAKESEGMGTWINRWFGATPNDTASLNNNVQLTIPAGSATLGD
FT                   HEATITWTLSDAPGV"
     ttgattatca aaaaaacatt aattgtagga ttaattggca taagttcagt cacacttttt        60
     gcaccggctg cttttgcagt aacttctgag ggagattcaa aagcaacagt taaatttaaa       120
     gctgggacgg gagtagttaa cccggttgac ccggaaaatc caacgaaacc gattgacccg       180
     ctagatccaa gtaatccaac tgatcctgga actggaaata ctggttcttt aacattggat       240
     tatgtgtcat ctgttaattt tggagaacat gaagtatcat ccacggaaca aagctactcc       300
     tccacatcaa gaaaaccgtt tatccaaata tctgaccgtc gtggaactgg agctggttgg       360
     aaagtgacag caaccgcaac cgcttttcaa aatgaagacg gtgcagcttc cctatcagga       420
     gcgacactat catttaaaaa cggagaaaca gcatctgcta gcaacacggc aacgacacca       480
     actgctgctc aaacagttga attaccaaca gatggaactt cgattgtgag tgttgtttcg       540
     gcaaaagaat cggaaggcat gggaacatgg attaatcgtt ggtttggtgc tacaccgaat       600
     gatacagcta gtttaaacaa caatgttcaa ttaacgatac cagcaggaag cgcaacactt       660
     ggagaccatg aagcgactat tacatggaca ttatctgacg cgccaggagt ttaa             714
//

If you have problems or comments...

PBIL Back to PBIL home page