(data stored in ACNUC10821 zone)

EMBL: AE017262.PE607

AE017262.PE607       Location/Qualifiers
FT   CDS_pept        632065..633090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0615"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16413035; match to
FT                   protein family HMM PF06030"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03397"
FT                   /protein_id="AAT03397.1"
FT                   /translation="MKKSFLSLLFIIPLLVTCSNFTEAQAAEGDVGYSVQAHIPANQID
FT                   KRQTYFDLKMQPKQKQTVNIDVMNSSNEEIQVEAAINYASTNRTGVIDYTKNDLTKKDK
FT                   SLEYPLPELAKIPDDQKLLTIPVDGKKTVQVMIEMPAESIDGVVLGAVEFKKKNTNETK
FT                   KTKGVSLKNEYSYIVGMQLAETDKQVKPHMNLLSIKPALLNYHTAIVAKLQNDQPVILE
FT                   NLSIDAKVYQQNSDKLLYQTKKANMKMAPNSNFDFGIDLENQPLKEGKYRLKMTATNGV
FT                   ETWTWDEAFTIGKEGQNLNKEAVNLEKTNTWLYVAIVAGVVLIALIIILVIRKRRQKQE
FT                   K"
     ttgaagaaaa gttttcttag tttattgttc attattccgt tattagttac atgtagcaat        60
     tttacagaag cacaggcggc agaaggagac gtcggttatt ccgttcaagc tcatattccc       120
     gccaatcaaa tagataaaag acaaacttat tttgacctaa aaatgcagcc gaaacaaaaa       180
     caaacagtaa acattgatgt aatgaatagt tcaaatgaag aaattcaagt ggaagcagca       240
     atcaactacg catccaccaa tcgaactggt gtcattgatt acaccaaaaa tgatcttacg       300
     aaaaaagata aaagtttaga atatccactt ccagaactag ctaaaattcc agacgaccaa       360
     aaactcctaa cgataccagt agatggcaaa aagaccgtcc aagtgatgat tgaaatgcct       420
     gctgaatcga ttgatggcgt tgtattgggc gcagtagaat ttaaaaagaa aaatactaac       480
     gagacgaaaa aaacaaaagg tgtctcctta aaaaatgaat attcctatat tgtcggcatg       540
     caactagctg aaaccgacaa acaagtcaaa ccacatatga atttactaag tatcaaaccg       600
     gcactcctta actatcacac agcgatagtt gccaaattac agaacgacca accagtcata       660
     ctggaaaatc taagtattga tgcaaaagtc tatcaacaaa attcggataa attactttac       720
     caaacaaaga aagcgaatat gaaaatggcg ccaaattcca attttgattt tgggattgac       780
     ttggaaaatc aacctttaaa agaaggtaaa tacagattaa aaatgactgc aacgaatggc       840
     gtggaaacct ggacttggga cgaagcgttc accattggta aagaaggaca aaacttaaat       900
     aaagaagcag taaacctaga gaaaacgaac acatggcttt acgttgcgat tgttgcaggt       960
     gtggttctta tagcactaat catcattttg gttataagaa aacgaagaca aaaacaagaa      1020
     aaataa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page