(data stored in ACNUC10821 zone)

EMBL: AE017262.PE608

AE017262.PE608       Location/Qualifiers
FT   CDS_pept        633108..635573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0616"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16413036"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03398"
FT                   /protein_id="AAT03398.1"
FT                   /translation="MAFKKLILVLTIAALFLGFKIVVAAENGSRDLASNEAIVTNFTEL
FT                   KTAISEDNGIDTVYLGADVELSGGIIIPATKKTFTLSGKNPTTGEIHTLTETMASAGAQ
FT                   SSVITVNTNTGAKETTLRDINVVGKNYYGTISVYGAAKNVVQNYENVHYQGPQMIYNLN
FT                   GTANFKGTNDITIASVVSGSAAPNEVAEIKGVSVSGKLNINHASSNANSAFWFGGGTAE
FT                   VNTFTVEENADVTILSNGTGMFYRSGAKPIDIDVKKNAKLAITSNNNIFRDTPGGAVKI
FT                   ASGADVTMTKTAGGNPLLWVADDITVSPDARFILNKTGGTGYIIQFYNATAKLDINDPR
FT                   SFLITTNSNTPMFYWPYANTFNLNAQMVNYWDTVGTIDRTDLASQSFSLPNGENVTGSL
FT                   TYTGTTTKILSTNTGMTPTNFNQNTARMIAMGRLEGTINPVTDADNEITGTATPNAFIS
FT                   ISYTENGENKVLEGQSNEAGTYRIAIPNGFIKPYIKLTTTIKQDQKRITLDDITVEDVT
FT                   PPSGEAVTQIIQLGDPFPDVAELVTNIYDHSDNTSGAGVTTTLQSAPDTNVFGPTEAIV
FT                   RLEDKAQNYVDIRVPVFIKDDETEIQDGKALRAADFSVNVKDIIELNDAELEQFILSKS
FT                   GAKAFNIETGEDLSAELKVASTNLKKETGTYAATIQIDGLTKEIAIQVTGELKFNHVPE
FT                   TISFETMELNQQKNIAKRNADFDLSVLDSRGSGGKFSVTATVKTPLTSTTNSAHTLPNG
FT                   LIFIDNTGAKKILSAEPITIFESQSASEMIVPIEWAEDQGILVEVDAAEAYVDESYETT
FT                   IEWTLTDAP"
     ttggctttca aaaaattaat acttgtattg accattgcgg ctctttttct tggttttaaa        60
     atagtggtag cagcggaaaa tgggagtagg gacttagcat caaatgaagc gatagtgact       120
     aattttacag aattaaaaac agctatttcc gaagataatg gaatagatac agtgtattta       180
     ggtgcagatg ttgaattatc gggtggaatt atcatcccag cgacgaaaaa aacatttact       240
     ttatcaggga aaaatccaac aacaggtgaa atacatactt tgacagaaac aatggcatca       300
     gctggtgccc agagcagcgt gattacagtt aataccaaca caggtgcaaa agagacaact       360
     ttaagagata ttaatgttgt ggggaaaaat tattatggga cgatttcggt ttatggggct       420
     gcaaaaaacg tcgtacaaaa ctatgaaaat gttcactatc aaggtccgca aatgatatat       480
     aatttgaatg gaacggcgaa ttttaaagga accaatgata taacaatagc gtccgttgta       540
     tctggttctg cggcaccaaa tgaagtcgcg gaaattaaag gcgtgagcgt ttccggtaag       600
     ttgaatatca atcacgcaag ttcgaatgcg aatagtgctt tttggttcgg tggtggaacg       660
     gctgaggtaa acacttttac agtggaagaa aatgcagacg tgacgatact ttctaatggg       720
     acagggatgt tttatcgttc aggggcaaaa ccaattgaca tagatgtgaa aaagaatgcg       780
     aagttagcta ttacttctaa caataatatt ttccgagaca caccgggcgg agctgttaaa       840
     atcgcgtcag gtgcggatgt aactatgaca aaaactgctg gcgggaatcc acttctatgg       900
     gtggcagatg atattaccgt aagtcctgat gcccgcttta tcttgaataa aacaggcgga       960
     actggctata ttatccagtt ttataatgcg acggcgaagt tagatataaa tgatcctcgg      1020
     agctttttaa ttacgacaaa ttcaaatacg ccgatgtttt actggcctta tgcgaacacc      1080
     tttaatttaa atgcgcaaat ggtgaattac tgggatacgg ttggaaccat tgatcgaacg      1140
     gatttggcat cgcaaagttt tagtttgcca aatggggaaa atgtgacggg gagtttgacg      1200
     tacacaggga caacgacaaa aattctgtca acgaatacgg gaatgacgcc gactaatttt      1260
     aatcaaaaca ctgcgcgaat gattgcgatg gggcgacttg agggaacgat aaatcctgtg      1320
     acagacgcag ataatgaaat tacaggaaca gcgacaccaa acgcttttat aagtatttca      1380
     tacacagaaa atggggaaaa taaggtttta gaaggacagt caaatgaggc gggaacttat      1440
     cgaattgcta ttccaaacgg ttttatcaag ccttacatta aattgactac aaccattaaa      1500
     caagaccaaa aaaggataac attagacgat ataactgtag aagatgtgac tccgccaagt      1560
     ggtgaggctg ttactcaaat tatccaactt ggagatccct ttccagatgt agccgaatta      1620
     gtaacaaata tttatgatca ttccgataat acatctggag cgggagttac aactacttta      1680
     caaagcgcgc ccgatactaa tgtatttgga cccacagaag ccattgttcg cttagaagat      1740
     aaggcacaaa attacgtgga tatccgtgta cccgttttta ttaaagatga tgaaacagag      1800
     atacaagatg gcaaagcatt acgagcggcg gacttttcgg taaatgtaaa agatattatc      1860
     gagctcaatg atgccgaact ggagcaattc attttaagca aatcgggtgc aaaagctttc      1920
     aatatcgaaa ctggtgagga cttaagcgcg gagttgaaag tagctagcac caatttgaaa      1980
     aaagagacag gcacctatgc ggcaacgata caaattgacg gattaacgaa agagattgcg      2040
     attcaggtta cgggtgagct taaatttaat catgtgccag aaacgatttc cttcgaaaca      2100
     atggagctta atcaacaaaa aaatatcgca aaacgaaacg ccgactttga tttatctgtg      2160
     cttgattcaa gaggctcagg cggcaaattt agcgtaacag caaccgttaa aacaccgctg      2220
     acatccacga caaattcggc gcatactttg ccaaatgggc tcatttttat tgataatact      2280
     ggagcgaaaa aaattctttc cgctgaacca atcaccattt ttgaatcgca gtcagctagt      2340
     gagatgattg ttccgataga atgggcagaa gaccaaggga ttttggtaga agttgatgca      2400
     gcggaggctt atgtggatga aagctatgaa acaacaatcg agtggacttt gacggatgct      2460
     ccgtaa                                                                 2466
//

If you have problems or comments...

PBIL Back to PBIL home page