(data stored in ACNUC10821 zone)

EMBL: AE017262.PE612

AE017262.PE612       Location/Qualifiers
FT   CDS_pept        639405..640178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0620"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF06966"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03402"
FT                   /protein_id="AAT03402.1"
FT                   /translation="MMYWTVALALLVYFILWFIISKIKGKYSLVDIAWGGGFVVVAWTG
FT                   FLTTFSMTAQSITILVLVTIWGVRLFWHLARRNWNKPEDYRYVNMRKRWGTTLVNLKAF
FT                   LNVFVLQGVLLFIIALPITHSFANETATFAWWQILGIVIWIIGFIFEVGGDLQLENFKK
FT                   NPANKGKLLTTGFWSVTRHPNYFGEALSWWGVFLVAYTQLNDLWLITSPIVITLLLLFV
FT                   SGVPLLEKKYQDRADFQAYANKTSKFFPFIGKKGL"
     atgatgtatt ggacagtagc actcgcttta cttgtttact ttatactctg gtttattatt        60
     tcaaaaataa aaggaaaata ttcgctcgtt gatattgcgt ggggcggcgg ctttgttgtt       120
     gtagcatgga ctggattttt aacgacattt agcatgacag cgcaaagtat aaccatactt       180
     gttttagtga cgatttgggg tgtccgtttg ttttggcatt tagcgcgccg gaattggaac       240
     aaaccagaag attatcgcta cgttaatatg cgcaaacgct ggggaacgac attagttaat       300
     ttgaaagcct tcttaaatgt cttcgtgttg caaggtgttt tattatttat tattgcttta       360
     ccgattacac atagttttgc taatgaaaca gcgacattcg cttggtggca aatcctcggt       420
     attgttatct ggattattgg ctttattttt gaagtcggtg gcgatttgca attagaaaac       480
     ttcaagaaaa atccagccaa taaaggcaaa ttattaacaa ctggattttg gtcagtcaca       540
     cggcatccaa attattttgg tgaagcactt agttggtggg gtgtattttt agttgcctat       600
     acgcaattaa atgatctctg gctgattact agcccgattg ttatcacttt attattacta       660
     tttgtttccg gtgttccgtt acttgaaaaa aaatatcaag acagagcgga ttttcaagca       720
     tatgcgaaca aaacgtcaaa atttttccct tttattggta aaaaaggtct gtaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page