(data stored in ACNUC10821 zone)

EMBL: AE017262.PE614

AE017262.PE614       Location/Qualifiers
FT   CDS_pept        641099..641875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0622"
FT                   /product="formate/nitrite transporter family protein"
FT                   /note="identified by similarity to SP:P11097; match to
FT                   protein family HMM PF01226"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03404"
FT                   /protein_id="AAT03404.1"
FT                   /translation="MQKIDYSTRKKIDLVNNSILRYIVRAMLACLFLTLGTAVAVMIGD
FT                   KVDHFAPGLGKITYAFMFSWSLVMIIYMNAELGTSNMMYMTTGVYQKIVKPGKALQILL
FT                   LCIVCNLLGGILAGYLVSLTSVFHNLPADHFLFTAVSGKLEKAPLQIFVEGIFANIVVN
FT                   TAVLCTLRMKDDAGKVIAMIFIIFIFAFLGFEHVIANFSSFSLAFFASGGTLAAMTAGN
FT                   VTVNLVLALLGNFVGGGLVIGLGYAWLNRTKSIYKD"
     atgcagaaaa ttgattatag tacgcgcaaa aaaattgatt tagtaaataa tagtattctt        60
     cgttatatcg tgcgcgcgat gttagcatgt ttattcttga cactagggac tgcggtcgct       120
     gtaatgattg gtgataaagt tgatcatttc gctccaggac ttggtaaaat cacgtatgca       180
     tttatgttta gttggtcgct cgttatgatt atttatatga atgctgagct tggtacttct       240
     aacatgatgt atatgacaac tggtgtttat caaaaaattg ttaaaccagg aaaagcatta       300
     caaattttgc ttttatgtat tgtttgtaat ttattgggtg gaattcttgc cgggtactta       360
     gtttccctaa catccgtttt ccataattta cctgctgacc atttcttatt tactgctgtt       420
     agcggtaagc ttgaaaaagc gccactacaa atttttgtag aaggtatttt cgccaatatt       480
     gttgtaaata cggccgtgct ttgtacactt cgaatgaaag atgatgctgg taaagtcatt       540
     gcgatgattt tcattatttt catctttgca ttcttaggat ttgagcacgt tatcgccaac       600
     ttctcctctt tctcattagc atttttcgct tctggtggaa cacttgctgc aatgacagcg       660
     ggcaatgtga ccgtcaattt agtacttgct ttacttggga attttgtggg tggaggcctt       720
     gttatcggac tcggctatgc ttggcttaac cgaacgaaat caatttataa agactaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page