(data stored in ACNUC10821 zone)

EMBL: AE017262.PE619

AE017262.PE619       Location/Qualifiers
FT   CDS_pept        complement(646153..646701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0627"
FT                   /product="BioY family protein"
FT                   /note="identified by match to protein family HMM PF02632"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03409"
FT                   /protein_id="AAT03409.1"
FT                   /translation="MRDQKLKFLVVDALFAVIIALLAQVAIPLGPIPLTGQTFAIGLAA
FT                   TILGARHGTISVLVYIVLGAVGIPVFQGMTAGIGILFGPTGGFIVGFIFNALLTGWLLE
FT                   KTKFTVPYAIVANILGAIVTLIFGVLWLKVSTGLDWPTAFLTGMVPFIIPGIIKAVFAA
FT                   LLGILIRDRLIKAKLLRAS"
     atgcgtgatc agaaattgaa atttttagtc gtagatgctt tattcgcagt catcattgct        60
     ttacttgcac aagttgctat cccacttggt ccaattccac ttactgggca gacgtttgcc       120
     attgggttag ctgcaaccat tcttggagct cgtcatggta ccatatctgt tttagtttac       180
     attgttcttg gcgctgtggg tattcctgtt ttccaaggta tgacagcagg aattgggatt       240
     ctttttgggc caactggcgg atttattgtc ggatttattt ttaatgcact acttacaggt       300
     tggttgctcg aaaaaacaaa attcactgtt ccttatgcaa ttgttgctaa tattttagga       360
     gccatcgtta cgttaatttt cggggtttta tggcttaaag ttagcactgg acttgactgg       420
     ccgaccgcct ttttaacagg catggtacct ttcattattc caggcattat caaagcggtt       480
     tttgcggcgt tattagggat tctcattcgt gatcgtttga ttaaagccaa attacttcga       540
     gcatcctaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page