(data stored in ACNUC10821 zone)

EMBL: AE017262.PE62

AE017262.PE62        Location/Qualifiers
FT   CDS_pept        64876..65025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02852"
FT                   /protein_id="AAT02852.1"
FT                   /translation="MQKGNVLLLMDFEIPVKRLKKRTIKLPYKSMFVNPLTILVANGTM
FT                   YSGK"
     atgcaaaaag gtaacgtatt actattaatg gactttgaaa ttcccgtaaa aagattaaaa        60
     aagcgaacga taaaattacc ttacaaatca atgttcgtaa atccattgac tattttagtg       120
     gcaaacggta caatgtatag tggaaaatga                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page