(data stored in ACNUC10821 zone)

EMBL: AE017262.PE622

AE017262.PE622       Location/Qualifiers
FT   CDS_pept        647803..648903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03412"
FT                   /protein_id="AAT03412.1"
FT                   /translation="MRKHHLSKKLFFAGLVLFIIGAIGVALTMNKGNMIEKGEPLTKQW
FT                   DLSAENINSIAFSSERDVTFEWKESTNGKNYIELKGNYSANDKKAIQKLDPVSEDGTSF
FT                   NITVPEEEDWYNGFGKIYAYGQQKVTVYLTKDTKLADLEVKSHSGDINVADFKVKKFVS
FT                   STNSGELKVSNLEANTAQMATSSGDLELSNMKANSSVETGSGQTDLTNLTGDLEVNGGS
FT                   GDVNVTGVKAKKLKIAIDSGDIELTSGTVTDLAVLTTSSGDIDASTKGKVQAESNSGAI
FT                   ELAGITNDVTAKTSSGDIDVAFIKQVKNIEINTDSGEVELELPGDFKAIYEASSNSGSI
FT                   KVPTSDSNTDNRVTVKTSSGDIKIEK"
     atgcgtaaac atcacttaag taaaaaatta tttttcgctg gtttggtact atttattatc        60
     ggtgctatcg gtgtagcatt aacgatgaac aaaggtaata tgatagaaaa aggtgaacca       120
     cttacaaaac agtgggactt atcagctgaa aatattaact ccattgcttt ttcttccgag       180
     cgcgacgtaa cgtttgaatg gaaagaaagt acaaatggaa aaaattacat cgaactaaaa       240
     ggtaattact ctgctaatga taaaaaagcc attcaaaaat tagatccagt ttcggaagat       300
     ggaacgtcct ttaatattac agttcctgaa gaagaggatt ggtataacgg ctttggcaaa       360
     atatacgcat acggtcaaca aaaagtaacc gtttatttaa caaaagatac taaattagct       420
     gatctagaag tgaaatctca ttctggggat atcaatgtag ctgattttaa agtaaagaaa       480
     tttgttagtt ctaccaactc aggtgagtta aaagtaagta atttggaagc aaatactgct       540
     caaatggcta cttcttctgg ggatttggaa ttatcgaata tgaaagcaaa tagctcagtt       600
     gaaactggtt ctggacagac ggaccttact aatttaacag gtgatttaga agtaaatggt       660
     ggttcaggcg atgtgaatgt tacaggtgtt aaagcgaaga aacttaaaat tgccatcgat       720
     tcaggagaca ttgagttgac tagtggcact gtaactgacc tagctgtgtt aacaacaagt       780
     tccggagaca ttgatgcaag tacaaaaggt aaagtacaag cggaatccaa ctcaggagca       840
     atcgaacttg caggcataac gaatgatgta acagcaaaaa caagctcagg tgatatcgat       900
     gtagctttta tcaaacaagt aaaaaacatc gaaatcaata cagattctgg tgaagtagaa       960
     cttgaactac caggtgattt taaagctatt tatgaagcaa gtagtaattc tggtagcatt      1020
     aaagtaccaa caagtgattc caatacggat aatcgcgtaa cggtaaaaac aagttccgga      1080
     gatattaaaa tcgaaaaata a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page