(data stored in ACNUC10821 zone)

EMBL: AE017262.PE623

AE017262.PE623       Location/Qualifiers
FT   CDS_pept        649009..649509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0631"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by similarity to OMNI:NTL01LI0607; match
FT                   to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03413"
FT                   /protein_id="AAT03413.1"
FT                   /translation="MNFHIRKATNSDAEAIQHVAITSWHHTYQDLIPGDVQDDFLERFY
FT                   NVETLHNRISATPFAVVEQADKVIGFANFIELEKGKSELAAFYLLPEVTQRGLGTELLE
FT                   VGMTLFHVPLPMFVNVEKGNETAIHFYKAKGFVQVEEFTEDFYGYPLETIRFNLNHHAF
FT                   EEE"
     atgaattttc atattaggaa agcaactaat tcggatgctg aagccattca gcatgtagcg        60
     attacttcgt ggcatcatac ctatcaagat ttaattccag gcgatgtaca agacgatttt       120
     ttggaaaggt tttataacgt tgagacgctt cataatcgta tttcagcgac tccttttgct       180
     gttgtggaac aagcagacaa agtaatcgga tttgcaaatt ttattgaact tgaaaagggg       240
     aagagcgaac tcgcagcatt ttatttacta cctgaagtga cacaacgcgg acttggtaca       300
     gagcttttag aagtaggaat gactctattt cacgtgccat taccaatgtt cgttaacgtc       360
     gaaaaaggaa acgaaacagc gattcatttt tataaggcga aagggtttgt tcaagtggag       420
     gaatttaccg aggattttta cggttatccg ctggagacaa ttcgttttaa tttgaatcat       480
     catgcgtttg aagaagaata a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page