(data stored in ACNUC10821 zone)

EMBL: AE017262.PE624

AE017262.PE624       Location/Qualifiers
FT   CDS_pept        complement(649557..649943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0632"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0608"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03414"
FT                   /protein_id="AAT03414.1"
FT                   /translation="MRFIIAYLSIFVLGIFSTLLVETILYDNVTPQLVFSAILFAAPVI
FT                   LVASTLGEIFYGFSKKASYFTFAIWGFAYGVVAAVIILSIIQVSGMLISVGVSILAGVI
FT                   MALLAIIFFFLRGGKSTSGKAATK"
     atgcgtttta ttattgctta tttatcgatt tttgttttag gaattttttc tacgctttta        60
     gtcgagacaa tcctctatga caatgttacg ccacagcttg tgttttcagc gatacttttt       120
     gcagctcctg taattttagt tgcttctacg ttaggcgaaa ttttttacgg gtttagcaaa       180
     aaagctagtt acttcacatt tgctatatgg ggcttcgctt acggggttgt tgcagcagtc       240
     atcattttaa gtattatcca agtttctggt atgctcattt ctgttggcgt atccattctc       300
     gcaggagtta tcatggcgct acttgccatc atcttcttct ttttacgcgg tggaaaatct       360
     accagtggaa aagccgctac gaaataa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page