(data stored in ACNUC10821 zone)

EMBL: AE017262.PE625

AE017262.PE625       Location/Qualifiers
FT   CDS_pept        complement(649997..650341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0633"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0609"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03415"
FT                   /protein_id="AAT03415.1"
FT                   /translation="MLDKKIISALSYFSLFFAPVITPAIIWCTTKDKEIRHHVRWALLT
FT                   QTTFVAGVVVMILLYNNVPFSTNSADTINFLALATVFFIVFLNVSILIFNLIRRITRIV
FT                   KHSDDNWARC"
     atgttagata aaaaaattat tagtgcgctt agttatttca gtcttttctt tgccccggtc        60
     attactcccg cgattatctg gtgtacaaca aaagataaag aaattcggca tcatgtaaga       120
     tgggcactcc tcacacagac aacttttgtc gctggtgtag ttgtaatgat tttactttac       180
     aacaatgttc catttagtac caatagtgca gataccatta actttcttgc cttagctact       240
     gtatttttta tcgtttttct aaatgtatcg atactcattt tcaacttgat tcggagaatt       300
     acacgtatcg taaagcatag tgacgataat tgggctagat gttaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page