(data stored in ACNUC10821 zone)

EMBL: AE017262.PE634

AE017262.PE634       Location/Qualifiers
FT   CDS_pept        659639..660580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0642"
FT                   /product="alcohol dehydrogenase, zinc-dependent"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03424"
FT                   /protein_id="AAT03424.1"
FT                   /translation="MKAVVIENYGGKEELKEKEVAMPKAGKNQVIVKEAATSINPIDWK
FT                   LREGYLKQMMDWEFPIILGWDVAGVISEVGEGVTDWKVGDEVFARPETTRFGTYAEYTA
FT                   VDDHLLAPLPEGISFDEAASIPLAGLTAWQALFDHAKLQKGEKVLIHAGAGGVGTLAIQ
FT                   LAKHAGAEVITTASAKNHELLKSLGADQVIDYKEVNFKDVLSDIDVVFDTMGGQIETDS
FT                   YDVLKEGTGRLVSIVGISNEERAKEKNVTATGIWLQPNGEQLKELGKLLANKTVKPIVG
FT                   ATFPFSEKGVFDAHALSETHHAVGKIVISFNK"
     atgaaagcag ttgtaattga aaattatggt ggcaaagaag aattaaaaga aaaagaagta        60
     gctatgccaa aagcgggtaa aaatcaagtg attgtcaaag aagcagcgac atcaattaac       120
     ccaattgatt ggaaacttcg tgaaggatac ttaaaacaaa tgatggactg ggaattcccg       180
     attattttag gatgggatgt agcgggtgtt atttccgaag ttggagaagg cgtaacagat       240
     tggaaagtcg gcgatgaagt attcgcacgc cctgagacaa cgcgttttgg tacgtatgct       300
     gaatatacag cggtagatga tcacttgctt gcaccacttc cagaaggaat tagttttgac       360
     gaagcagcat cgattccact tgcaggctta actgcttggc aagcattgtt cgatcacgcg       420
     aaattacaaa aaggtgaaaa agtcttgatt catgctggtg ctggtggtgt tgggacgttg       480
     gcgattcagc ttgccaaaca tgcaggagca gaagtaatca caacagctag tgcgaaaaac       540
     catgaattac taaaatctct tggcgcagac caagtcattg attataaaga agttaatttt       600
     aaagatgttc tttctgatat tgatgtggtg ttcgatacaa tgggtggtca aatcgaaaca       660
     gatagttatg acgtattaaa agaaggcaca gggcgtttag ttagtatcgt tggtatttca       720
     aatgaagaac gtgcgaaaga aaaaaatgta acagcaactg gaatttggtt gcaaccaaac       780
     ggcgaacagc tgaaagaact tggcaaattg cttgctaata aaacggttaa accaatcgtc       840
     ggcgcaactt tcccattctc tgaaaaaggt gtttttgatg cacatgcatt aagcgaaacg       900
     caccacgcgg ttggaaaaat agtcatttca tttaataaat aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page