(data stored in ACNUC10821 zone)

EMBL: AE017262.PE635

AE017262.PE635       Location/Qualifiers
FT   CDS_pept        660675..661208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0643"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by similarity to OMNI:EF0951; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03425"
FT                   /protein_id="AAT03425.1"
FT                   /translation="MEIRELKNGQIIMIREATKEDSSNIITYLNEVAGETDYLSFGQGE
FT                   FAFSIAEEAEYIEENDKNPGSVMLLCFIDDELASISQLMGHMKKRELHTSELAISIRKK
FT                   YWGLGIGTICMGELIKYAKSSEYLKLIYLEAVSENKRAINLYKKFGFIEAGEIPALMQV
FT                   DSRYLDVTMMYLVI"
     atggaaataa gagaattgaa gaatgggcaa ataataatga ttcgggaagc tacaaaagag        60
     gactctagta atattattac ttatttaaat gaagtagctg gtgagacaga ttatttatca       120
     tttggtcaag gtgagtttgc gtttagtata gcggaagaag ctgaatacat agaagaaaat       180
     gataagaacc caggctctgt tatgttgtta tgttttattg atgatgaact tgcgagtatt       240
     tctcaactta tggggcatat gaaaaagcga gaattacata cttctgaact agctatttcg       300
     atacggaaga aatattgggg tctaggtatt ggcacaattt gcatgggtga attaataaaa       360
     tacgctaaaa gtagcgagta tttaaagctt atctatttag aagctgtatc agagaataaa       420
     cgcgcaatta atttgtacaa aaaatttgga tttatcgaag ctggtgaaat tccagcgtta       480
     atgcaagtgg acagccgtta tttagatgta accatgatgt atttggttat ttag             534
//

If you have problems or comments...

PBIL Back to PBIL home page