(data stored in ACNUC10821 zone)

EMBL: AE017262.PE640

AE017262.PE640       Location/Qualifiers
FT   CDS_pept        665167..665622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0648"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0624"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03430"
FT                   /protein_id="AAT03430.1"
FT                   /translation="MDGEKETSKLLHELKKATNLRQVLDENEAEFKSSEMVTYLKELLA
FT                   EKKLTKASVIRAARLHETYGYQIFSGVRRPSRDRTIALSFGFKLTGLEASRLLKYTEYP
FT                   PLYAKNRRDAIIIFALDHGYTLDQTNDSLYDLEEALIETYKEEKPLI"
     atggatgggg aaaaagagac aagtaagtta cttcatgaat taaaaaaagc gaccaattta        60
     cgccaagtat tagatgaaaa cgaggcggaa tttaaatcaa gcgaaatggt tacctattta       120
     aaagaattat tagcagagaa aaaattaaca aaagcaagcg tcattcgtgc ggcgagactc       180
     catgaaacat atggatacca aattttcagt ggcgttagaa gaccgtcacg cgaccggacg       240
     atcgctcttt cttttggatt taaattaact ggtttagaag caagtagatt attaaaatat       300
     acagaatatc cacctcttta tgcaaaaaat cggcgggatg cgattattat ttttgcgtta       360
     gatcatggtt atacgctaga ccaaacgaat gattcactct atgatttaga ggaagcatta       420
     atcgaaacat ataaagaaga aaaaccactt atttag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page