(data stored in ACNUC10821 zone)

EMBL: AE017262.PE641

AE017262.PE641       Location/Qualifiers
FT   CDS_pept        665678..666070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0649"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0625"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03431"
FT                   /protein_id="AAT03431.1"
FT                   /translation="MINEQTILQAATSEKNAGDFPKVVQSFKELGVTKYQFLVEKGIYV
FT                   FWDEMDNQVESKLNGVSMPISEEISRDRLKDAIKQAQAGKIDFEIFIKLAGLAGVRLWE
FT                   ADLSAMKVTYIDNTGNDLIVEPIPSI"
     atgattaatg aacaaacaat tttacaagca gcaacaagtg aaaaaaacgc cggagatttt        60
     cctaaagtag ttcaaagttt taaagaatta ggcgtaacta aatatcaatt tttagtcgaa       120
     aaaggtattt atgtattttg ggatgaaatg gataatcaag tagaatccaa gttaaatgga       180
     gtttctatgc caatctccga agaaatttca cgcgacagac tgaaagatgc aattaaacaa       240
     gcacaagcgg gaaaaataga ttttgaaata tttattaaac tagctgggct agcaggtgtc       300
     agactgtggg aagctgattt atctgcaatg aaagtaacct atatagataa tacgggaaat       360
     gatttgatcg tggaaccgat tccgagtatt taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page