(data stored in ACNUC10821 zone)

EMBL: AE017262.PE642

AE017262.PE642       Location/Qualifiers
FT   CDS_pept        666167..666907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0650"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0626; match
FT                   to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03432"
FT                   /protein_id="AAT03432.1"
FT                   /translation="MDIITYFLIALSTSVVGSFLGIGGGVILLPILLLMGVSQGTAAFS
FT                   SALTVFTMAIFTCSIYYKRKQGNVGLALKIAVTSIPTTFLGAMVNQMLPEAVYRFLYGA
FT                   LIVVLLGIMIWKKKRHNEKPHFLSEYRIIPYVFGVIIGFLAGLFGIGGGPIVIPILLLI
FT                   FMLNQKTASATSSYVTLLTSLASIGSYAIIGGSDFSIGIYMIPGAIIGALIGTRLNKLL
FT                   DEKWIAILFNVLLIALFALNLIKI"
     atggatataa ttacgtactt tctaattgca ctaagtacaa gtgttgtagg gagtttttta        60
     ggaataggtg gcggagttat tcttttgcca attctactct taatgggtgt ttctcaagga       120
     acagcagcat ttagttcggc tcttactgtg ttcacgatgg cgattttcac ttgtagtatt       180
     tattacaaga gaaagcaagg gaatgtaggc ttggcactga aaattgccgt aactagtatt       240
     ccaacgactt ttcttggcgc aatggtgaat caaatgttgc ctgaagcagt ctatcgcttt       300
     ttgtatggag cattaatcgt tgttttacta gggataatga tttggaaaaa gaaacgacat       360
     aatgaaaaac cacatttttt aagtgaatat cggataattc catatgtatt cggtgtaatt       420
     atcggttttt tagctggctt atttggtatt ggtggcgggc caatcgttat accaattttg       480
     ctgttaattt tcatgttgaa tcaaaaaacg gcatccgcga catccagtta tgtgacatta       540
     ctgacgtccc ttgcaagtat cggttcctat gcaatcattg gtggaagtga cttttcgatt       600
     ggtatttaca tgataccagg ggcaatcatc ggtgcgctaa ttggcacaag attaaataaa       660
     ctcctggatg aaaaatggat tgcgattcta ttcaatgttt tacttatcgc cctttttgct       720
     ttaaatttaa ttaagattta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page