(data stored in ACNUC10821 zone)

EMBL: AE017262.PE644

AE017262.PE644       Location/Qualifiers
FT   CDS_pept        667288..667566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0652"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0628"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03434"
FT                   /protein_id="AAT03434.1"
FT                   /translation="MDEPTKAVIYQILSKTEEQNATMDHLVFEMMQFPGAAAFTKNELL
FT                   FGIYWLETYHYIFRMNENQKTRYYRTEKGHEKLAELELLKKNSKKTT"
     atggatgagc caaccaaagc agtgatctat caaattttat ctaaaacaga agaacaaaat        60
     gcgacgatgg atcatttggt tttcgaaatg atgcaattcc ctggtgccgc ggcttttact       120
     aagaatgaat tgctgtttgg catttattgg ctagaaacgt atcattatat ttttcgaatg       180
     aatgaaaatc aaaagacgag atattaccga acagaaaaag ggcatgaaaa attagcagag       240
     ctagaacttt taaaaaagaa tagtaaaaaa acaacttga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page