(data stored in ACNUC10821 zone)

EMBL: AE017262.PE647

AE017262.PE647       Location/Qualifiers
FT   CDS_pept        complement(668854..670533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0655"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03437"
FT                   /protein_id="AAT03437.1"
FT                   /translation="MWKKHKWLIIAVLLLVIYVAPLFILGGNSHVRIHDNLDSNVTWYK
FT                   MVLDSGDYTAKVGTANIDQIMDDSVPRDSFDSEFVGIDWLYMIFSTPIAFAMSQLITRV
FT                   FAFLGLFLWARDYLIKDKKYLVPLYFVSLAFALTPFWPSGMLSTLGMPLALWAFLNIRN
FT                   NKRRIWNVVILTLLPFYSSLILGFCFFLVMVGCIWLYDVFKKKQVNIRFLLSMLYMTLL
FT                   YALVNYRFIYAMFLHPEPDSRSEFSLPELSFLSSIRLSFKNFIIGHTHDQALAGFVIIP
FT                   VLLLVLALIIIKREWGKEKLFLWLFGFNLFLSFWYGFWWYRGWNVIKEHVEIMRTFNFS
FT                   RFHFLQPFLFYGLFALAIVYLIKKGNWWRKLAYVVVALQLVVVFANNSEIYYRTGNGSP
FT                   SINQFYATEQMEEIKDYIGKPQSSYRVGSIGLHPSVSQESGFYTVDGYVNSYPLAYKRA
FT                   FRKIIAGELDKSPVLEDYYDNWGNRCYIFSAELGKNYDFGKDSKKHIKQLDFNSEAFKK
FT                   VGGKYILSAVPIDNASEVGLQFEKAFDNKESYWKIYLYKATK"
     atgtggaaaa agcataagtg gctaattatt gctgtattat tattggtaat ttatgtcgct        60
     ccattattta ttcttggcgg gaacagtcat gtaaggattc atgataactt ggattctaat       120
     gtaacttggt acaaaatggt tttggatagc ggggattata ccgctaaagt cgggacagca       180
     aatatagatc aaataatgga tgacagcgtc cccagagatt catttgattc agagtttgtt       240
     gggattgatt ggctttacat gattttcagc acacccattg cctttgcgat gagtcagtta       300
     attacacgtg tttttgcatt tttaggatta tttttatggg caagggatta ccttattaaa       360
     gataaaaaat atctcgtgcc actttatttt gtttccttag cttttgcgct aacaccattt       420
     tggccatcag ggatgttgag tacgcttgga atgccgcttg ctctatgggc atttttaaat       480
     attaggaata ataaacggcg aatttggaat gtggttatac tgacgttgct tccattttat       540
     tctagtttaa tattaggatt ttgtttcttt ttagtaatgg ttggatgtat ttggttgtac       600
     gatgttttca agaaaaaaca agtgaatatt cgatttttac ttagcatgct ttatatgacg       660
     cttctgtatg cacttgtaaa ttatcgtttt atttatgcaa tgtttttgca ccccgaaccg       720
     gattcaagga gcgaatttag tctaccagag ttatcatttt taagttctat ccgacttagc       780
     tttaaaaatt tcattatagg acacacgcat gaccaggcac tggctggatt tgttattata       840
     cctgtattac tccttgtact tgcactcatt attatcaaac gtgaatgggg caaagaaaaa       900
     ctgtttttat ggctatttgg ctttaattta ttcttatctt tttggtatgg attttggtgg       960
     tatcgtggtt ggaatgtaat caaagaacac gtggaaatca tgcggacatt taacttttcg      1020
     cgcttccatt ttttacaacc gtttttattt tatggactgt ttgcacttgc gattgtttat      1080
     ttaataaaaa aaggaaattg gtggcgaaag ttagcttatg tggtagttgc gctgcagctt      1140
     gttgttgttt tcgctaataa ctctgagatt tactaccgca ctggaaatgg ctcgccaagc      1200
     attaatcaat tttacgccac ggagcaaatg gaagaaatta aagattatat tggtaaaccg      1260
     cagtcaagtt accgtgtcgg aagtattggt ctgcacccgt ctgtttccca agaaagtggc      1320
     ttttatactg tcgatggcta tgtgaattcc tatcctcttg cttataaaag ggctttccga      1380
     aaaattattg ctggtgagct agacaagagt cctgttttag aagattatta tgataattgg      1440
     ggtaatcgtt gttatatatt ttctgccgaa ttaggtaaaa actacgattt cggcaaggat      1500
     tcgaaaaaac acattaaaca gttagatttt aattcagagg catttaaaaa ggttggcggc      1560
     aagtatattc tatcagctgt tccgattgat aatgcttcag aagttgggct acagttcgaa      1620
     aaagccttcg ataataagga atcttactgg aaaatctatt tatacaaagc aactaaataa      1680
//

If you have problems or comments...

PBIL Back to PBIL home page