(data stored in ACNUC10821 zone)

EMBL: AE017262.PE648

AE017262.PE648       Location/Qualifiers
FT   CDS_pept        670836..675596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0656"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF05738;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03438"
FT                   /protein_id="AAT03438.1"
FT                   /translation="MLKHNWQKVFVVMVAVTLIFQLVPWSNIFAGAEENQTKTTQQIAQ
FT                   SDEQKGADENKTTVTSDNRETTKNLVNGKQLLKGSVDWNFTNKVTDANGNTKQTYAPGD
FT                   SLKFSISLAIPSYSESVLDETYTFWIQKDFFQGDKVTFVNPAIDGLTPRQNVFTDDSMK
FT                   NSIGTKTINGVEYIGYTLKFNQSPEALAKYEDEPLTNAKFDMFATINTTITTKDDYKAI
FT                   VIEDDKDVDISNIEVPVTPPTPDTDNGVLTASKAIDSAWRLDKDTGKYLKVATSSTNYT
FT                   PEKDDLVFYYVYATNNSAENAVLEKMVDELPAGFSIITEGSPEWQALSTASGSSLQRGW
FT                   VASADQTNLAPGATRYELPFSPAQTISKNGGGIYKTIAAKVTDPTKDLTNVTKSPTKGG
FT                   EGKSGSVTPSGKDVYDMAITTKISSTYDKNNKYIGAVSSTTTPVSISEGSTVGVTYTAI
FT                   NQGNYTKDVVVYAYVPAGYELNNDTSDFKTTNDKWKYETTVPSGGGVWSDIKVYSITLS
FT                   GGMASGATATATMYMKAIGMPDDGTYSAVDFYMAGEIGSFSNFNGDSTLDGAITDVDST
FT                   PDMNPGNDLISNVDGSTVKPIDGFQKEKPHVVKENAKSTATLQDEDDFDFDYVTFIKTP
FT                   EVIPSEGKVFEKTRLSAADAEKTARNMIGSDIMGSALKDYTPLADDGRITSPKTYMVYE
FT                   MNINPSGVEDTLNSSFTDTLPKGLKMLEYDIAGLNSSNKHIYGFTTNKFEGTPKFTNAD
FT                   GQDVIVYQKGLYSEKQVCIANPTLNDVGVRYFGNNADKMGVTGSVTKDARTLTLNFGQP
FT                   AADPMYSETKAAYKVYMIVVIDPDEIDYSSIMQNKATYTYNDKVITSYENSEMYWDAGG
FT                   GTAYAKKYVLDNKTNAYLSGSQYNVATPDADGNLSVGYKIRVRSAYEFDKSSINIGDII
FT                   AADNFKSISNVEVNGYEASPNTGFQIDGELENPVPLAADKYAVEAKATANTLDITNPVD
FT                   IPQMQLYNVLFKVNYQKVKYGAKLVNQAAGSEVATVVPLNLNLLKQDDISKTALTGYEF
FT                   KAYYADENGKADLTKPVKDTNSNEIVMTDSSGAANFIPTGYKTTSKNQEWKVVLVETKT
FT                   PTGYESNENKEYPVTVKSDANGNLSIPATTETSLEITNNDHGATTATIDNHADVKMIDV
FT                   NGAKTWTGDTEADRPDSIEVQLLQDGVAYGSPITVTKADDWKYEFKNVPETNADGNKYT
FT                   YTVLENTVTNYTSAVTGLDINNTLIKPDVKMINLDGQKTWKNDTENDRPASIEIQLQQN
FT                   GQDYGFPVTVTKDSDWKYEFKNLPETTNDGAAYNYTIVEKAVPGYETKVDGMNVINTKI
FT                   DAPKTTVSGEKTWKNDTAKDRPDYIEVQLLQNGQTYGDPVKVTKENDWKYSFKDLPKGD
FT                   ANNNDYRYSVTEIAVPGYKTTTDGMNLTNTKVTDEKNVTTASGTKTWVGDNEKTRPASI
FT                   EVQLLQNGKAYGTPIKVTAKSNWKYNFTNLPEKDKTGEKYSYTVSEKQVSGYSVKVKGM
FT                   DLTNTKVTKTTPKDTPKNTPKDTHSTNKPSKTKKLPGTGDTNGMLLFAGGLVLLFLGLH
FT                   LRRKSTK"
     atgctaaaac acaactggca aaaagtattc gttgtaatgg ttgcggttac gcttattttt        60
     caattggttc cgtggtctaa tatcttcgcc ggagcagaag aaaatcaaac aaaaacaacc       120
     caacaaatag cacaatcaga tgaacaaaaa ggagcagatg aaaacaaaac aaccgtaaca       180
     tctgacaata gagagacaac taaaaatcta gttaatggaa agcaattact aaaaggctct       240
     gttgactgga attttacaaa taaagtaact gacgcaaacg ggaatacaaa acaaacttat       300
     gcaccgggag actcactcaa gttttcaata agtttggcaa tcccatccta ttcagaatca       360
     gtattggatg aaacttatac attttggata caaaaagact tctttcaagg agacaaagta       420
     acatttgtta atccagcaat tgatggatta acaccgagac aaaatgtttt tacagacgac       480
     tccatgaaaa actcgattgg aacaaaaaca ataaatggtg tcgagtatat tggttacacg       540
     ctcaaattta accaaagccc agaagccttg gcaaaatatg aagatgagcc gcttactaac       600
     gctaaatttg atatgtttgc aacaataaat acgactatta caacgaaaga tgactataaa       660
     gctattgtaa ttgaagatga taaagacgta gatattagta atattgaagt ccccgtgaca       720
     ccaccaactc ccgatacaga taatggtgta ctcaccgcgt ctaaagcaat cgattctgct       780
     tggcggttag ataaagacac tggaaaatat cttaaagtcg ctacatcatc tacaaactat       840
     acacctgaaa aagatgatct agttttctat tatgtgtatg ctacgaacaa ttcagcggaa       900
     aatgccgttt tagaaaaaat ggtagatgaa ttaccagctg gtttttccat tattacggaa       960
     ggctcaccag aatggcaggc gttatcaact gcatctggct cttcgcttca acgcggctgg      1020
     gtagcttcag cagaccaaac aaaccttgcc cctggcgcaa ctaggtacga attaccattt      1080
     tccccagctc agacaatctc caaaaatggt ggcggtattt ataaaacgat cgcagcaaaa      1140
     gtaacagatc caacgaaaga tttgactaat gttactaaaa gcccaactaa aggcggcgaa      1200
     ggtaaatctg gttctgtaac accaagtggg aaagatgttt atgacatggc aattacgaca      1260
     aaaattagtt ccacttacga taaaaacaat aaatatattg gtgctgttag tagcacaact      1320
     acgcccgttt ctatatcaga aggaagcaca gttggcgtaa catatacagc gattaatcaa      1380
     gggaattata caaaagatgt tgtcgtttat gcctatgtac cagcaggtta tgaactaaat      1440
     aatgatacat ctgatttcaa aactacgaat gataaatgga aatacgaaac aaccgtacct      1500
     agtggtggcg gtgtgtggag tgatatcaaa gtttactcca ttacactttc tggaggcatg      1560
     gcatcaggtg caactgcaac tgcgaccatg tacatgaaag ctatcggcat gccagatgat      1620
     gggacttata gcgcagtaga cttttacatg gctggagaaa tcggttcatt ttctaacttt      1680
     aatggtgatt ctactttaga cggagcaatt accgatgtag attcgacgcc agatatgaat      1740
     ccaggaaatg atctgattag caatgttgat ggttctactg taaaacctat tgatggcttc      1800
     caaaaagaaa aaccccatgt tgtaaaagaa aatgctaaat caacagcgac tttacaagat      1860
     gaagatgatt tcgattttga ttatgttacg ttcattaaaa caccagaagt aattccatca      1920
     gaaggaaaag tgtttgaaaa aacacgtcta tcagcagctg atgcagaaaa aacagcgcgc      1980
     aatatgatag gtagcgacat catgggttct gccttgaaag actatacgcc tcttgccgac      2040
     gatggtagaa ttacttcacc aaaaacatat atggtctatg aaatgaacat taacccatct      2100
     ggagtagaag acacactaaa ttcttcgttc acagatacac ttccaaaagg attgaaaatg      2160
     cttgaatatg atattgctgg tttaaattct agcaataaac acatttatgg ttttacaacg      2220
     aacaaatttg aaggtacacc gaaattcaca aatgcagacg gacaagatgt tattgtttat      2280
     caaaaaggct tatattccga gaaacaagtt tgtattgcca accctacttt aaatgacgtt      2340
     ggagtaaggt atttcggaaa taacgcggat aaaatgggtg taactggttc cgtaacaaaa      2400
     gatgcacgta cactaaccct taattttgga caaccggcag ctgacccgat gtatagtgaa      2460
     acaaaagcag cttataaagt gtatatgatt gtggtaattg atccagacga aattgactac      2520
     agcagtatca tgcaaaataa agcaacatac acttacaacg ataaagttat tacttcttat      2580
     gaaaatagcg aaatgtactg ggatgctggt ggcggtacgg cctatgcgaa aaaatatgtt      2640
     ttagataata aaacaaatgc atatttaagt ggaagccaat ataatgtagc tactcctgat      2700
     gcagacggta atttgtcagt tggctataaa attcgagtaa gaagtgccta tgaatttgat      2760
     aaatcatcta taaacattgg agatattatt gctgcagata attttaaatc tatctctaat      2820
     gtagaagtaa atggttatga ggcaagtcca aacacgggct tccaaattga cggggaactt      2880
     gaaaatcctg taccacttgc tgcggataag tatgcggtag aagcaaaagc aactgcaaac      2940
     acattagata tcacaaaccc agttgacatt ccacaaatgc aactatataa cgttcttttc      3000
     aaagtgaatt atcaaaaagt gaaatatggc gcgaaactag ttaaccaagc agcagggtca      3060
     gaagttgcaa ctgttgttcc attaaactta aatcttctaa aacaagatga tataagcaaa      3120
     acagcattga caggctatga attcaaagct tattatgcag atgaaaatgg aaaagcagat      3180
     ttaacgaaac cggtcaaaga tacaaatagt aatgaaattg ttatgacaga ctcatccggc      3240
     gcagcaaatt tcatcccgac aggttataaa acaacttcta aaaatcaaga atggaaagta      3300
     gttcttgttg aaacaaagac accaactggt tatgaatcaa atgaaaataa agagtatcca      3360
     gttacagtga aaagcgatgc gaatggcaac ttatccattc cagccactac agaaacaagc      3420
     cttgaaatca ccaataatga tcacggagca acaacagcga ctattgacaa ccatgcggat      3480
     gtgaaaatga ttgatgtgaa tggcgcgaaa acttggactg gtgacacaga agcagatcgc      3540
     ccagattcca tcgaagtaca acttttgcaa gacggtgtag catacggtag cccaattact      3600
     gtaacaaaag cagacgactg gaaatacgaa ttcaaaaatg ttccagaaac aaatgcagat      3660
     ggaaataaat acacgtatac agttttagaa aatacagtta ctaactatac aagtgctgtc      3720
     acaggtcttg atattaacaa cacgttaatc aaaccagatg taaaaatgat taatcttgac      3780
     ggacaaaaaa catggaaaaa cgatacagaa aatgaccgtc ccgcatccat cgaaattcaa      3840
     ctgcaacaaa atgggcaaga ttacggtttc ccagtaacag ttacaaaaga tagcgattgg      3900
     aaatacgaat ttaaaaacct accagaaaca accaatgatg gagcggctta caattacacg      3960
     attgtcgaaa aagcagttcc aggctatgag accaaagtcg acggaatgaa cgtcatcaac      4020
     acgaaaatag atgcaccaaa aaccactgtc tctggtgaaa aaacatggaa aaacgacaca      4080
     gccaaagacc gtccagacta tatcgaagta caacttttac aaaatggaca aacttatggt      4140
     gatccagtca aagtaacgaa agagaacgac tggaaatata gcttcaaaga tttacctaaa      4200
     ggcgatgcta acaacaacga ttatcgttac tctgttactg aaatagcagt tccaggctac      4260
     aaaacaacca cagatggaat gaacttaacc aatacaaaag taaccgatga gaaaaatgta      4320
     actacagcga gcggcacaaa aacttgggtg ggagacaatg aaaaaacacg tcccgcatcc      4380
     atcgaagttc aacttttaca aaacggtaaa gcatacggaa caccaatcaa agtaacagca      4440
     aaatcgaatt ggaaatacaa ctttaccaac cttccagaga aagacaaaac aggtgaaaaa      4500
     tacagctata ctgtatctga aaaacaagta tctggctata gtgtaaaagt aaaaggtatg      4560
     gacttaacga atacaaaagt aacaaaaacg acaccaaaag atacaccaaa aaatacacca      4620
     aaagatacac attctaccaa taaaccaagt aaaacgaaaa aattacctgg aactggtgat      4680
     acgaatggta tgttgctatt tgctggtgga ttagtactat tattcttagg tctacacctt      4740
     agaagaaaaa gtaccaaata a                                                4761
//

If you have problems or comments...

PBIL Back to PBIL home page