(data stored in ACNUC10821 zone)

EMBL: AE017262.PE649

AE017262.PE649       Location/Qualifiers
FT   CDS_pept        675693..675968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0657"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0633"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03439"
FT                   /protein_id="AAT03439.1"
FT                   /translation="MKEELLQAIEVGEPVLLVTAIGYIVGIVETKGELIRLNDVYINCV
FT                   SASRVNRFSRGLAVNVNQVIGMQLLSKSEKDEMIGGWKAYVAPTAG"
     atgaaagaag aattactgca agcaatcgaa gtcggcgagc cagttttact tgtaacagca        60
     atcgggtata ttgtaggaat tgtggaaaca aaaggagagc ttattcgctt aaatgatgtg       120
     tatatcaatt gtgtttcagc tagcagggta aatcgtttca gccgaggctt agctgtgaac       180
     gtcaatcaag tcatcggtat gcaactatta agtaagtcgg agaaagacga aatgattggc       240
     ggctggaagg catacgtggc acctacagct ggctaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page