(data stored in ACNUC10821 zone)

EMBL: AE017262.PE650

AE017262.PE650       Location/Qualifiers
FT   CDS_pept        676011..676538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0658"
FT                   /product="hydrolase, isochorismatase family"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03440"
FT                   /protein_id="AAT03440.1"
FT                   /translation="MILLVVDTQKLIMTNNLYNFDSLVPNIEQLIVTARKNKIEIVYIR
FT                   HDDGPNTELTEGKEGFEIYEKFQPTTLERIFDKSVNSAFKGTGLLEYLKEKSTKKIVIA
FT                   GLQTDFCIDATVKCGFEHGFHMIVPAHANSTEDNHFMSGENSYKYYNEWMWPERYATCI
FT                   SMEETINEMEHN"
     atgatattat tagttgttga tacacaaaaa ttaattatga cgaataatct atacaatttc        60
     gattcacttg tacccaatat agaacaatta atcgtcactg ctcgaaaaaa taaaatagaa       120
     atagtttata tacgacatga cgacggacct aatacagaac ttacagaagg aaaagaaggc       180
     ttcgaaattt acgaaaaatt ccaaccaacc acactcgaaa gaatttttga taaaagcgtt       240
     aatagcgctt ttaaaggaac aggcttactt gaatatttaa aagaaaaaag cacgaaaaaa       300
     attgtaatag ccgggttgca aactgatttt tgcatcgatg ccacggtgaa gtgtggcttt       360
     gaacatggtt ttcacatgat cgttcccgcc catgccaatt cgacggaaga taaccacttt       420
     atgtcagggg agaatagtta caagtactat aatgaatgga tgtggcctga gcgttacgcg       480
     acctgtatat ctatggaaga aacgattaat gaaatggaac ataattga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page