(data stored in ACNUC10821 zone)

EMBL: AE017262.PE656

AE017262.PE656       Location/Qualifiers
FT   CDS_pept        682153..682857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0664"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03446"
FT                   /protein_id="AAT03446.1"
FT                   /translation="MINLIFDIDDTVYDQLKPFENAFKTVFGKADHLKIENLYIKSRFY
FT                   SDEVYHRVVQGEMPKAKMHVYRITQALNDFDYQITKKEAEAFQHAYEQNQRKIELTSGI
FT                   KEILTWAKKNEITMGIITNGPKEHQQHKINDLQINDWIPTEHTFISGKVGIEKPDKKIF
FT                   KLVEEQIGIKGAETYYIGDSFENDVIGSKSAGWKSIWLNRRGHLIPTEAAFQPDYCVEN
FT                   EQQLFAILQEIF"
     atgattaatt taatttttga tattgatgac acagtttatg accaattaaa accatttgaa        60
     aacgcattta aaactgtttt tggaaaagcg gaccacctga aaatcgaaaa tttatatatt       120
     aaaagtcgat tttatagtga tgaagtgtat caccgcgttg tccaaggcga aatgccgaaa       180
     gcaaaaatgc acgtttatcg tattacgcag gcgctaaatg attttgatta tcaaattact       240
     aaaaaagaag cagaagcctt tcaacacgcc tacgaacaaa accaacgcaa aatcgaactt       300
     acgtcaggga ttaaagaaat tctcacatgg gcgaaaaaga acgaaatcac gatgggaatc       360
     attacaaacg gaccaaaaga acatcaacaa cataaaataa atgatttaca aatcaatgat       420
     tggattccaa ccgagcacac gttcatttct ggtaaagtcg gtattgaaaa accagacaag       480
     aaaatattta agctagtaga agaacaaatc ggtattaagg gtgccgaaac ctattatatt       540
     ggcgattctt tcgaaaatga tgttatcggt tcaaaaagtg ctggttggaa atcaatttgg       600
     ttgaatagac gaggacattt gataccaaca gaggcagcat ttcagccaga ttattgtgtt       660
     gaaaatgagc aacaattatt cgcaatttta caggagatat tttaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page