(data stored in ACNUC10821 zone)

EMBL: AE017262.PE657

AE017262.PE657       Location/Qualifiers
FT   CDS_pept        682962..683378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0665"
FT                   /product="Rrf2 family protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0657; match
FT                   to protein family HMM PF02082; match to protein family HMM
FT                   TIGR00738"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03447"
FT                   /protein_id="AAT03447.1"
FT                   /translation="MKFSKATNYALHTMVYLANLSPEKSVGVKELATKQNVSPTYLSKV
FT                   LTMLVKAGFIESVTGVNGGYKLAEPASSISFLDVIQAIEGKGAFFHCDPKNHSESQPHC
FT                   LIGEVMNKAEQQMEDYLSKQTVGSIVVEIEKHQH"
     atgaaatttt ccaaagcaac caattatgca ctacatacga tggtttattt agctaatttg        60
     tcaccagaaa agtctgtcgg tgtgaaagaa cttgcaacca agcaaaatgt gtcgccaact       120
     tatctatcta aagtgttgac gatgctagtg aaagctggct ttattgaatc agtaacaggc       180
     gtcaatggtg ggtataagtt agcggaacca gcaagtagta ttagttttct tgatgtcatt       240
     caagcgattg aagggaaggg cgcctttttc cattgtgacc ctaaaaacca cagcgaaagc       300
     cagccgcact gcttgattgg cgaagtgatg aataaggcgg agcaacaaat ggaagattat       360
     ttaagcaaac aaacagtagg tagtattgtc gtagaaattg aaaaacatca acattaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page