(data stored in ACNUC10821 zone)

EMBL: AE017262.PE658

AE017262.PE658       Location/Qualifiers
FT   CDS_pept        683391..683984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0666"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /note="identified by match to protein family HMM PF01209"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0666"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03448"
FT                   /protein_id="AAT03448.1"
FT                   /translation="MKHHHNHHGEAGFKRKVDYLDRPERSEVLSPEDFLQAMPIGKTAS
FT                   ILDLGAGTGFLTIPAAKFVDNTVFALDLDAKMLELIESKAKEAGLANVETLEASMDDIP
FT                   LEANSVDVVLASLVLHEADSLADVLREVSRVVKTGGYFASLEFDTKGTDLKGPPMEIQI
FT                   SAEKLKEELAGFGFEVVKNWQLDEGMYVSIAVKK"
     atgaaacatc atcataatca tcacggggaa gctggtttta agcggaaagt agattatttg        60
     gatcgaccag agcggagtga agtgctgtcg ccagaggatt ttttgcaggc aatgccaatc       120
     ggaaaaacag caagtatttt agatttagga gcgggaacag gatttttaac aattccagct       180
     gcaaaattcg ttgataatac agtttttgca ttagatttag atgcgaaaat gttggaatta       240
     attgagtcaa aagcgaagga agcaggtttg gctaatgtag aaacgttaga agccagcatg       300
     gatgatattc cacttgaggc aaattccgtg gatgttgtgc tcgcatcgct cgtgttacat       360
     gaagcagatt cgctcgcaga tgttttgcgc gaagtgagta gagttgtgaa gactggcggc       420
     tactttgcta gtttggaatt tgacacgaaa gggactgatt taaaaggccc accaatggaa       480
     attcagattt ctgcggagaa attgaaggaa gagcttgcgg gatttgggtt tgaagtggtg       540
     aagaattggc agttggatga gggtatgtat gtgagtattg cggtgaagaa gtaa             594
//

If you have problems or comments...

PBIL Back to PBIL home page