(data stored in ACNUC10821 zone)

EMBL: AE017262.PE66

AE017262.PE66        Location/Qualifiers
FT   CDS_pept        67116..70322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0068"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02856"
FT                   /protein_id="AAT02856.1"
FT                   /translation="MKKVKWSILLFLVLAIFLSAGITYLALNQSSNKESKNNSEKTHKM
FT                   TIALVNEDQGDNFQGKQVEFGNQFVKSIEKDDTHEWYVVSRGVAESGLKRDVYNMMIVI
FT                   PSDFSEKAMSMTSSAPEKVTISYKVNDVGNSDLKAEAEKTAASVLEDFNSRIIDVYFAS
FT                   ILTTLQEAQDNIGTLVKEEKKYDAIYNKDVNNPLSSYTKQFKTVQDYTGTSKESFQGFQ
FT                   DIMKEFEESLNLSQKENEEHMKNMDAYTKTQEENAPFGAEFTENLSKFDGTLSAEDIRM
FT                   QTAALEQANAKMTSEFQILEDSNSLLSQTQALQSYIAETNARIDAVDAEIMGTLENDFR
FT                   TAVYNDLLRILRENEYSDKLNEIGLKDLTGEDINAGFNKMIVKEIQSLPTYSADQLASI
FT                   GLDEEMYKNVVTLSKEYYSNHRSAFGEGFSFTTDPKTLPTDTLKSDTINRLKSEGVTLE
FT                   SSSYTVEGSDYPTEIILTLDENFTFSDVDCLVNGSSNPELVQQTAYGENGIKLSIQALG
FT                   STPAEIKITGKAKLREGVNVPLIGAVNWNATLQQYEKKEYSEMPTIPSELDPTTPDTSL
FT                   IVRKEPVPIKVTAPTYLNETKSSVKAITNTVKDYYKLQALFDLYYGIDASDSGQIPDFS
FT                   NYQVTLENSAKASSYYYIFNKEDVIGSFVNLTTDRFVADYTKKIKAFEKRIDDYKNTMA
FT                   EANSRSEDVTNRLNETTQEAINLNTNLALTLQNLESWREASKGLIEENGVVLEKSGEEA
FT                   TMALQLSSEFAGLLAESESLAGTSEGNLKSAEVVYKTFDAIDKEAKNIQQSGETLVKEA
FT                   STLSDDLSEKLEDDETFQKNFAKVMENSRVGDRQNENLYSFLSSPVDKMNAGTIVAGDK
FT                   SMPYFMILICTILAIFTSYVISHQEKKREQLNEFEKEMSLVFKNIPITFLAICVGIIEG
FT                   LIIGAISGFIFEVGEIGMFLWIGVCVLIMMTLVTAFSYLLRQFNMIGMSIILLVLSLYL
FT                   FLTDAVGLNIDNESIFATFRTFSPLQYMEYLLNGILSAQKDYIIVVYSLIGAALLFTGL
FT                   NLFVWHRSKEEVEEDDSDEI"
     atgaagaaag taaaatggag tattttactc tttttagtct tggcgatttt tctttcggca        60
     ggaattactt atttggcttt gaatcaaagt tcgaataagg agtctaaaaa taatagtgaa       120
     aaaacacaca agatgactat cgcacttgta aatgaggacc aaggagacaa cttccaaggt       180
     aaacaagtag agtttggtaa tcaatttgtt aaaagtattg aaaaagatga tacgcatgaa       240
     tggtacgttg ttagccgcgg agttgcagaa agtggcttga aacgagatgt atacaatatg       300
     atgatcgtta tcccgagtga cttttctgaa aaagcaatgt caatgacttc gagcgccccg       360
     gaaaaagtga caattagcta caaagttaac gatgtaggaa atagcgattt aaaagcggaa       420
     gccgaaaaaa cagcagcttc tgtattggaa gatttcaatt cacggattat tgatgtttat       480
     tttgcaagca ttttaacaac tttacaagaa gcgcaggata atattggaac cctagttaaa       540
     gaagagaaaa agtatgacgc tatctacaac aaagatgtaa ataatccgtt atccagctac       600
     acaaaacagt ttaaaacggt gcaagactac acaggaactt ctaaagagag cttccaaggt       660
     ttccaagata ttatgaaaga atttgaggaa agcctaaatc tctctcaaaa agaaaacgaa       720
     gaacatatga aaaacatgga tgcttataca aaaacacaag aggaaaatgc tccttttggg       780
     gcagaattca cagaaaactt gtcaaaattt gatggcactt tatcagcaga agatattcga       840
     atgcaaacgg ccgctttaga acaagccaat gcgaaaatga cttcagaatt tcaaatttta       900
     gaagatagta attcattgtt atcacaaaca caggccttac agagctatat agctgaaacc       960
     aatgcacgga ttgatgcggt ggatgccgag attatgggaa cgctcgaaaa tgattttcgg      1020
     acggctgttt ataatgactt gttgcgtatt ttacgagaaa acgagtactc ggataagttg      1080
     aatgaaattg ggcttaaaga tttgaccgga gaagatatta atgctggctt taacaaaatg      1140
     attgttaagg aaatacaatc attaccaaca tatagtgcgg atcaattagc gtcgattggg      1200
     cttgatgaag agatgtacaa aaatgttgta acgctctcta aggaatatta tagtaaccat      1260
     cgcagtgctt ttggcgaagg ttttagcttt acgactgatc ccaaaactct accaactgac      1320
     acactgaaaa gcgatacgat taatcgattg aaatccgaag gggtcacgct agaaagcagt      1380
     tcctatacgg tggaaggtag cgattatcca acagaaataa ttctaacttt agatgaaaat      1440
     ttcacttttt cagatgttga ttgtttggtt aatggaagca gtaatccaga gttagttcaa      1500
     caaaccgcat acggagaaaa tggcataaag cttagtatac aggcgcttgg aagtacaccg      1560
     gcagagatta aaatcaccgg aaaagcgaag ttgcgagaag gtgtgaatgt tccattaatt      1620
     ggtgctgtaa attggaatgc tacactgcag caatatgaga aaaaagaata tagtgaaatg      1680
     ccaacaattc catcagagct tgatcctact accccggata cttcattaat agttagaaaa      1740
     gaacctgtac cgattaaggt cactgcacca acatatttga atgagacgaa gagttctgta      1800
     aaagcaatta ctaatacagt aaaagattac tataaactac aagcattatt tgatttatat      1860
     tacggaattg atgcgagtga ttctggacaa ataccggatt ttagtaatta tcaagtgaca      1920
     ttagaaaatt ctgcgaaagc atcctcgtat tattatattt ttaataaaga agatgtgatt      1980
     ggtagctttg taaatcttac tacagatcgg tttgtggcag attatacgaa aaaaatcaaa      2040
     gcttttgaga agcgaattga tgactacaaa aatacaatgg ctgaggccaa ttccagatca      2100
     gaagacgtaa caaatagatt aaacgaaacg acgcaagaag ctattaattt aaatacaaat      2160
     ctagcgttaa cgttgcaaaa cctagaatct tggcgagagg caagtaaagg tttaatagaa      2220
     gaaaatggcg ttgttttaga aaaatctggc gaagaagcca cgatggcact gcaattaagc      2280
     tccgagtttg ccgggctttt agcggaaagt gaatcgttag ctggtacttc tgaaggtaat      2340
     ttgaagtcag cggaagtcgt gtacaaaact tttgatgcga ttgataagga agccaaaaat      2400
     attcaacaaa gcggagaaac tttagtaaaa gaagcatcta cactatccga tgatttaagc      2460
     gaaaaattgg aagacgacga aacgttccag aaaaatttcg ctaaggttat ggaaaatagc      2520
     cgtgttggtg atcgacaaaa tgaaaatcta tatagtttct taagtagtcc ggtcgataag      2580
     atgaatgctg ggactattgt tgcgggtgac aaatcaatgc catacttcat gattttgatt      2640
     tgtacgattc tggcaatttt cactagctac gttatttcac accaagagaa aaaacgtgaa      2700
     caattaaatg aatttgagaa agaaatgtcg cttgtcttta aaaatattcc aattactttc      2760
     ctagcgattt gtgttgggat tattgagggg ctcataatag gcgccatttc aggatttatt      2820
     tttgaagttg gagaaattgg gatgttccta tggataggtg tctgcgttct aattatgatg      2880
     acgttagtta ctgctttttc atatttatta cgtcagttca acatgattgg gatgtcgatt      2940
     attttactcg ttttaagttt gtatctattc ttaacggatg cagttggact taacattgat      3000
     aatgaatcta ttttcgcgac gttcagaacg ttctcgccac ttcaatacat ggaatactta      3060
     ttgaatggga ttttaagtgc ccagaaagat tacattattg tcgtatacag tttgattggg      3120
     gcggctctat tatttactgg tctcaaccta tttgtctggc accgttctaa agaagaagta      3180
     gaggaggacg attcagatga aatttaa                                          3207
//

If you have problems or comments...

PBIL Back to PBIL home page