(data stored in ACNUC10821 zone)

EMBL: AE017262.PE664

AE017262.PE664       Location/Qualifiers
FT   CDS_pept        689866..690594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0673"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0673"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03454"
FT                   /protein_id="AAT03454.1"
FT                   /translation="MKKINWTQWIALFVFASMGISVVFTIYEIFTAPIKQPATGPHVTL
FT                   RGDYIFLLFEIILGIFILLLPSIIARRFKFEIPGLVYILFIVFLYGSIYLGTVQKFYST
FT                   VPHWDKILHTFSGAMLGAIGFSFVSLLNANNKVVMKLKPGFIAVFAFCFAVTMGAFWEV
FT                   YEYTFDGIMNLNMQRYNLSNGTPLTGRAALEDTMTDIIVDIIGALFIVIVGYFALKKGR
FT                   PWMERFEFKRKNWKKEPKKK"
     atgaaaaaga tcaattggac acaatggata gcattatttg tttttgcgtc aatggggatt        60
     tctgttgttt ttactattta cgaaattttt acagcaccga tcaagcagcc agcaactggg       120
     ccgcatgtga cgttacgagg ggactatata tttttactat ttgaaattat attaggaatt       180
     tttattttgt tgctaccttc gattattgca cgacgcttca aatttgaaat acctggtctt       240
     gtgtatattt tgtttattgt atttctatac ggatccattt atcttggtac agttcaaaaa       300
     ttctattcaa ccgtgccaca ttgggataaa attttacata cttttagtgg ggcgatgctt       360
     ggagcaattg gcttttcgtt cgttagtttg ctaaatgcta ataacaaagt tgtcatgaaa       420
     cttaaaccgg gttttatcgc tgtattcgcg ttttgtttcg cggtgacaat gggggctttc       480
     tgggaagtgt atgagtatac ttttgatgga attatgaact taaatatgca acgttataat       540
     ctatctaatg gaacaccgct cactggccgc gctgcactgg aagatacgat gacagatatt       600
     attgtcgata ttattggcgc actatttatc gtcatcgtcg gctattttgc actgaaaaaa       660
     ggccgaccat ggatggaacg ctttgaattc aagcggaaaa attggaagaa agaaccgaag       720
     aaaaaatag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page