(data stored in ACNUC10821 zone)

EMBL: AE017262.PE665

AE017262.PE665       Location/Qualifiers
FT   CDS_pept        690734..691384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0674"
FT                   /product="putative transaldolase"
FT                   /note="identified by match to protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0674"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03455"
FT                   /protein_id="AAT03455.1"
FT                   /translation="MFLDTGKLEEIKKALQFPFFEGVTTNPTILLKENKPRNTHIANIP
FT                   AKVVFVQAAGLTEEEIWEDVLRIQAIEPAEGTVIGLKIPAHEAGIKVIAKVRANFPNEI
FT                   ILATAIFSSEQGYIAALSGADYLAPYYNRMEVSGLDAAKTIEELRYVLDLQGLEDVKIM
FT                   GASFKNSRQIMQALASGADTVTIGYDLFLQMMNKPLALESIEKFNEHQAALPK"
     atgtttttag atacggggaa attagaggaa ataaagaaag cgcttcaatt tccgtttttt        60
     gaaggtgtaa ccactaatcc gactatttta ttaaaggaga ataagccgag aaacacgcat       120
     atagcgaata ttccagccaa agttgtgttt gtgcaagcgg ctgggttaac ggaagaggaa       180
     atctgggaag atgtccttcg aattcaagca attgagccgg cagaaggtac ggtaatcggc       240
     ttgaaaatcc cagcccacga agccgggata aaagtcatcg caaaagttcg cgctaatttt       300
     ccaaatgaaa ttattttagc aacagcaatt ttctcatcgg aacaaggtta tattgcagcg       360
     ctctctgggg cagattattt agcgccatat tataatcgca tggaagtaag cggactagac       420
     gcagcgaaaa caatagaaga actacgatac gtgttagatt tacaaggact tgaagatgtg       480
     aaaattatgg gagcaagctt taaaaatagt cgtcaaatta tgcaagcact agctagtgga       540
     gctgataccg ttacaatcgg ttatgattta tttttacaaa tgatgaacaa acctctagcg       600
     cttgaaagta ttgaaaaatt taatgaacat caagccgctt taccaaaata a                651
//

If you have problems or comments...

PBIL Back to PBIL home page